[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS82166.1


[Show Plain Result]

## Summary of Sequence Search
   1::536
 203::302  2.4e-31 52.0% 0050575 00505753 3/5   ic acid-binding proteins                
 359::456  1.4e-30 47.4% 0050575 00505755 5/5   ic acid-binding proteins                
 206::290    4e-29 49.4% 0047019 00470193 3/5   ic acid-binding proteins                
 367::451    4e-29 49.4% 0048887 00488875 5/5   ic acid-binding proteins                
 280::365  5.8e-27 50.6% 0048887 00488874 4/5   ic acid-binding proteins                
  11::130  8.5e-27 39.0% 0050575 00505751 1/5   ic acid-binding proteins                
 195::278  1.3e-26 46.4% 0048887 00488873 3/5   ic acid-binding proteins                
 378::463  1.6e-26 47.1% 0047019 00470195 5/5   ic acid-binding proteins                
 291::377  5.3e-26 49.4% 0047019 00470194 4/5   ic acid-binding proteins                
 370::451  1.6e-25 47.6% 0051771 00517715 5/5   ic acid-binding proteins                
 368::451    2e-25 47.6% 0047828 00478285 5/5   ic acid-binding proteins                
 205::286  5.9e-25 42.7% 0052107 00521073 3/5   ic acid-binding proteins                
 201::283  3.5e-24 51.9% 0040675 00406753 3/5   ic acid-binding proteins                
 373::456    1e-23 50.0% 0040675 00406755 5/5   ic acid-binding proteins                
 283::365  1.2e-23 50.0% 0051771 00517714 4/5   ic acid-binding proteins                
 281::365  1.4e-23 50.0% 0047828 00478284 4/5   ic acid-binding proteins                
 286::370  1.5e-23 47.0% 0040675 00406754 4/5   ic acid-binding proteins                
 206::286  2.1e-23 45.7% 0051177 00511773 3/5   ic acid-binding proteins                
 198::278  2.8e-23 48.1% 0051771 00517713 3/5   ic acid-binding proteins                
 196::278  7.2e-23 48.2% 0047828 00478283 3/5   ic acid-binding proteins                
 376::452  2.8e-22 47.4% 0049455 00494555 5/5   ic acid-binding proteins                
 377::459  7.4e-22 48.1% 0052107 00521075 5/5   ic acid-binding proteins                
 204::279  3.7e-21 52.0% 0049455 00494553 3/5   ic acid-binding proteins                
 290::373  3.7e-21 41.2% 0052107 00521074 4/5   ic acid-binding proteins                
 209::283    7e-21 34.7% 0049427 00494273 3/5   ic acid-binding proteins                
 381::456  1.5e-20 40.8% 0049427 00494275 5/5   ic acid-binding proteins                
 289::366  9.4e-20 50.0% 0049455 00494554 4/5   ic acid-binding proteins                
 294::370  9.5e-20 41.6% 0049427 00494274 4/5   ic acid-binding proteins                
  30::118  2.1e-19 37.5% 0047019 00470191 1/5   ic acid-binding proteins                
 119::202    3e-19 33.3% 0047019 00470192 2/5   ic acid-binding proteins                
 108::189  4.2e-19 29.3% 0048887 00488872 2/5   ic acid-binding proteins                
 292::373  7.1e-18 39.5% 0051177 00511774 4/5   ic acid-binding proteins                
 379::456  2.6e-17 45.5% 0051177 00511775 5/5   ic acid-binding proteins                
  19::105  4.4e-17 38.8% 0048887 00488871 1/5   ic acid-binding proteins                
 111::189  5.5e-17 31.6% 0051771 00517712 2/5   ic acid-binding proteins                
 109::189  6.6e-17 32.1% 0047828 00478282 2/5   ic acid-binding proteins                
  25::110    7e-17 45.1% 0040675 00406751 1/5   ic acid-binding proteins                
 114::194  7.9e-17 38.8% 0040675 00406752 2/5   ic acid-binding proteins                
 386::443  1.4e-16 53.4% 0046451 00464515 5/5   ic acid-binding proteins                
 299::357  1.7e-16 54.2% 0046451 00464514 4/5   ic acid-binding proteins                
 201::278  2.1e-16 47.2% 0038590 00385903 3/5   ic acid-binding proteins                
 373::451  3.2e-16 40.3% 0038590 00385905 5/5   ic acid-binding proteins                
 286::365  4.3e-16 44.4% 0038590 00385904 4/5   ic acid-binding proteins                
 214::270    2e-15 50.9% 0046451 00464513 3/5   ic acid-binding proteins                
  22::105  2.8e-15 39.0% 0051771 00517711 1/5   ic acid-binding proteins                
 303::358  4.4e-15 51.8% 0050575 00505754 4/5   ic acid-binding proteins                
  20::105  5.1e-15 39.3% 0047828 00478281 1/5   ic acid-binding proteins                
  28::106  6.5e-15 44.7% 0049455 00494551 1/5   ic acid-binding proteins                
  33::110  9.7e-15 39.5% 0049427 00494271 1/5   ic acid-binding proteins                
 290::365  1.2e-14 40.6% 0047715 00477154 4/5   ic acid-binding proteins                
  29::113  1.9e-14 38.3% 0052107 00521071 1/5   ic acid-binding proteins                
 118::197  5.4e-14 36.2% 0052107 00521072 2/5   ic acid-binding proteins                
 122::194  1.8e-13 31.5% 0049427 00494272 2/5   ic acid-binding proteins                
 205::278  2.3e-13 44.1% 0047715 00477153 3/5   ic acid-binding proteins                
  25::105  4.7e-13 44.4% 0038590 00385901 1/5   ic acid-binding proteins                
 377::451  6.4e-13 40.6% 0047715 00477155 5/5   ic acid-binding proteins                
 117::190  9.7e-13 34.2% 0049455 00494552 2/5   ic acid-binding proteins                
  30::107  4.3e-11 43.4% 0051177 00511771 1/5   ic acid-binding proteins                
 119::190  6.5e-11 37.5% 0051177 00511772 2/5   ic acid-binding proteins                
 114::189  3.5e-10 31.9% 0038590 00385902 2/5   ic acid-binding proteins                
  29::103  3.8e-10 46.3% 0047715 00477151 1/5   ic acid-binding proteins                
 134::194  4.1e-10 37.7% 0050575 00505752 2/5   ic acid-binding proteins                
  38::97   1.6e-08 40.0% 0046451 00464511 1/5   ic acid-binding proteins                
 127::181  2.1e-05 29.1% 0046451 00464512 2/5   ic acid-binding proteins                
 118::187  0.00022 33.3% 0047715 00477152 2/5   ic acid-binding proteins                
   1::536


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
00505753   3/5  ----------------------------------------------------------------------
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  ----------------------------------------------------------------------
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ----------------------------------------------------------------------
00505751   1/5  ----------islslkelledsllsl.edlkvGdvvtGtVvsvtdfgvfVdlglggveGlvpiselsddl
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  ----------------------------------------------------------------------
00406753   3/5  ----------------------------------------------------------------------
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  ----------------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  ----------------------------------------------------------------------
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  -----------------------------lkvGevveGtVvsvtdfgafVdlg.gveGlvhiselsddrv
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  ------------------lldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpiselsdk
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ------------------------ellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsll
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ---------------------pwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpiselsdd
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  -------------------ldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpiselsdd
00494551   1/5  ---------------------------edlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrv
00494271   1/5  --------------------------------GdivkGkVvkilpglegafVdiglgvegflpiselsle
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ----------------------------kpfkgevveGvVtsvtkfgvfVdlggv.egfvpiselsddrv
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ------------------------yeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels....
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  -----------------------------PfkgevveGtVvsvtkfgvfvdlggv.egfvplselsddrv
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------kdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvs
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  -------------------------------------GtVtsvtdfgafVdlgggveGlvhiselsddll
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYEKGEPVTVTIKERVKGGVVAE
00505753   3/5  ----------------------------------------------------------------------
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  ----------------------------------------------------------------------
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ----------------------------------------------------------------------
00505751   1/5  .rvedpeevlkvGdevkvkvlsvdpekgrisLSlkkalleeaweeleealevgeiveGtv----------
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  ----------------------------------------------------------------------
00406753   3/5  ----------------------------------------------------------------------
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  ----------------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  ----------------------------------------------------------------------
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  lfdeerlalvgedpsevlkvGdevevkvlevdlergeldllrivLslk----------------------
00470192   2/5  ------------------------------------------------lkvGevveGtVvsvtdfgafVd
00488872   2/5  -------------------------------------lldpwellledlkvgdvvkGtVvsitdfgafVd
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  r..vedpedvlkvgdevevkvlevdkekgrivLSl-----------------------------------
00517712   2/5  ----------------------------------------pwellledlkvgeivkGtVvsvtdfgafVd
00478282   2/5  --------------------------------------ldpwellledlkvgevveGtVvsvtdfgafVd
00406751   1/5  kr..vedpsell.vGdevkvkvlevdkekgrivLslkkll------------------------------
00406752   2/5  -------------------------------------------ellellevgdvveGkVv.itdfgvfVd
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  rve..dlsdvlkvgdevevkvlsvdkekgrivLSl-----------------------------------
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  r..vedlsdvlkvgdevevkvlevdkekgrivLSl-----------------------------------
00494551   1/5  ..edleevlkvgdevkvkvlkvd.ekgrivLslkkl----------------------------------
00494271   1/5  llllelslkr..vedisdvlkvGqevlvkvlkvdlgnkgi------------------------------
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ydfdekllllvgedlelvlkvgdevrvkvlevdkeegrivlsl---------------------------
00521072   2/5  -----------------------------------------------kpfkgevveGvVtsvtkfgvfVd
00494272   2/5  ---------------------------------------------------GdivkGkVvkilpglegaf
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ....pgevlkvgdrvkvkvlevdkerkgivlslkr-----------------------------------
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  ----------------------------------------------edlkvgeivkGtVvsvtdfgafVd
00511771   1/5  fdedenllvw.edlelvlkvgdevrvkvlgvdlekgr---------------------------------
00511772   2/5  ------------------------------------------------PfkgevveGtVvsvtkfgvfvd
00385902   2/5  -------------------------------------------yeefklkegeivtGtVvrvtkggvfVd
00477151   1/5  eli........pgevlkvgdrvkvyvlevdkes-------------------------------------
00505752   2/5  ---------------------------------------------------------------dfgvfVd
00464511   1/5  llrvedlsdvlkvgdevevkvlevdke-------------------------------------------
00464512   2/5  --------------------------------------------------------GtVtsvtdfgafVd
00477152   2/5  -----------------------------------------------kdregeivtGtVkrvaraeergg


                         +         -         -         -         -         *         -:210
query           LDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQ
00505753   3/5  --------------------------------------------------------------ledlkvGd
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  -----------------------------------------------------------------lkvGe
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ----------------------------------------------------------------------
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  ------------------------------------------------------lldpwellledlkvgd
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  ----------------------------------------------------------------kpfkge
00406753   3/5  ------------------------------------------------------------ellellevgd
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  -----------------------------------------------------------------Pfkge
00517713   3/5  ---------------------------------------------------------pwellledlkvge
00478283   3/5  -------------------------------------------------------ldpwellledlkvge
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ---------------------------------------------------------------edlkvge
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  --------------------------------------------------------------------Gd
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  lggveGlvhiselsddrvlfdeerlalvgedpsevlkvGdevevkvlevdlergeldllriv--------
00488872   2/5  lgelggveGlvpiselsdkrvedpedvlkvgdevevkvlevdkekgriv---------------------
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  lgelggveGlvpiselsddrvedlsdvlkvgdevevkvlsvdkekgriv---------------------
00478282   2/5  lgelegveGlvpiselsddrvedlsdvlkvgdevevkvlevdkekgriv---------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  lgelggveglvpiselsllkrvedpsellvGdevkvkvlevdkekgrivLslkk----------------
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ------------------------------------------------------------yeefklkege
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  lggvegfvpiselsddrvydfdekllllvgedlelvlkvgdevrvkvlevdkeegri-------------
00494272   2/5  VdiglgvegflpiselslellllelslkrvedisdvlkvGqevlvkvlkvdlgn----------------
00477153   3/5  ----------------------------------------------------------------kdrege
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  lglgveGlvpiselsddrvedleevlkvgdevkvkvlkvd.ekgrivLsl--------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  lggvegfvplselsddrvfdedenllvwedlelvlkvgdevrvkvlgvdl--------------------
00385902   2/5  lggvegllplsels....pgevlkvgdrvkvkvlevdkerkgivlslkr---------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  lglggveGlvpiselsddlrvedpeevlkvGdevkvkvlsvdpekgrisLSlkk----------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  lgggveGlvhiselsddllllrvedlsdvlkvgdevevkvl-----------------------------
00477152   2/5  vfvdlggeeegvegllpvseli....pgevlkvgdrvkvyvlevdke-----------------------


                         -         -         -         +         -         -         -:280
query           VVEGTVVEVTDFGVFVNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALI
00505753   3/5  vvtGtVvsvtdfgvfVdlglggveGlvpiselsddlrvedpeevlkvGdevkvkvlsvdpekgrisLSlk
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  vveGtVvsvtdfgafVdlggveGlvhiselsddrvlfdeerlalvgedpsevlkvGdevevkvlevdler
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ---------------------------------------------------------------------l
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  vvkGtVvsitdfgafVdlgelggveGlvpiselsdkrvedpedvlkvgdevevkvlevdkekgrivLS--
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  vveGvVtsvtkfgvfVdlggvegfvpiselsddrvydfdekllllvgedlelvlkvgdevrvkvlevdke
00406753   3/5  vveGkVv.itdfgvfVdlgelggveglvpiselsllkrvedpsell.vGdevkvkvlevdkekgrivLsl
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  vveGtVvsvtkfgvfvdlggvegfvplselsddrvfdedenllvwedlelvlkvgdevrvkvlgvdlekg
00517713   3/5  ivkGtVvsvtdfgafVdlgelggveGlvpiselsddrvedlsdvlkvgdevevkvlsvdkekgrivLS--
00478283   3/5  vveGtVvsvtdfgafVdlgelegveGlvpiselsddrvedlsdvlkvgdevevkvlevdkekgrivLS--
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedleevlkvgdevkvkvlkvd.ekgrivLslkk-
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  ivkGkVvkilpglegafVdiglgvegflpiselslellllelslkrvedisdvlkvGqevlvkvlkvdlg
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ivtGtVvrvtkggvfVdlggvegllplsels......pgevlkvgdrvkvkvlevdkerkgivlslkr--
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ---GtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvgdevevkvlev----------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ivtGtVkrvaraeerggvfvdlggeeegvegllpvseli......pgevlkvgdrvkvyvlevdkesk--
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
00505753   3/5  kalleeaweeleealevgeive------------------------------------------------
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  geldllrivL------------------------------------------------------------
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpiselsd.krvedpedvlkvgdevevk
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------lkvGevveGtVvsvtdfgafVdl.ggveGlvhiselsd.drvlfdeerlalvgedpsevl
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  egrivl----------------------------------------------------------------
00406753   3/5  kkl-------------------------------------------------------------------
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  --pwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpiselsd.drvedlsdvlkvgdevevk
00478284   4/5  ldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpiselsd.drvedlsdvlkvgdevevk
00406754   4/5  -----ellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllkrvedpsell.vGdevkvk
00511773   3/5  rivlsl----------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  ---------kpfkgevveGvVtsvtkfgvfVdl.ggvegfvpiselsddrvydfdekllllvgedlelvl
00494273   3/5  nkg-------------------------------------------------------------------
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  --------edlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsd.drvedleevlkvgdevkvkvl
00494274   4/5  -------------GdivkGkVvkilpglegafVdiglgvegflpiselslellllelslkrvedisdvlk
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  -----------PfkgevveGtVvsvtkfgvfvdlg.gvegfvplselsddrvfdedenllvwedlelvlk
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ------------------GtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdvlkvgdevev
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  -----yeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels.......pgevlkvgdrvkvkvl
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  ----------------------svtdfgvfVdlglggveGlvpiselsddlrvedpeevlkvGdevkvkv
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  ---------kdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli.......pgevlkvgd
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
00505753   3/5  ----------------------------------------------------------------------
00505755   5/5  --------islslkelledsllsl.edlkvGdvvtGtVvsvtdfgvfVdlglggveGlvpiselsddlrv
00470193   3/5  ----------------------------------------------------------------------
00488875   5/5  ----------------lldpwellledlkvgdvvkGtVvsitdfgafVdlgelggveGlvpiselsdkrv
00488874   4/5  vlevdkekgrivLSl-------------------------------------------------------
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  ---------------------------lkvGevveGtVvsvtdfgafVdl.ggveGlvhiselsddrvlf
00470194   4/5  kvGdevevkvlevdlergeldllrivL-------------------------------------------
00517715   5/5  -------------------pwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpiselsddrv
00478285   5/5  -----------------ldpwellledlkvgevveGtVvsvtdfgafVdlgelegveGlvpiselsddrv
00521073   3/5  ----------------------------------------------------------------------
00406753   3/5  ----------------------------------------------------------------------
00406755   5/5  ----------------------ellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllkr
00517714   4/5  vlsvdkekgrivLSl-------------------------------------------------------
00478284   4/5  vlevdkekgrivLSl-------------------------------------------------------
00406754   4/5  vlevdkekgrivLslkklle--------------------------------------------------
00511773   3/5  ----------------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  -------------------------edlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrved
00521075   5/5  --------------------------kpfkgevveGvVtsvtkfgvfVdl.ggvegfvpiselsddrvyd
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  kvgdevrvkvlevdkeegrivls-----------------------------------------------
00494273   3/5  ----------------------------------------------------------------------
00494275   5/5  ------------------------------GdivkGkVvkilpglegafVdiglgvegflpiselslell
00494554   4/5  kvd.ekgrivLslkkl------------------------------------------------------
00494274   4/5  vGqevlvkvlkvdlgnkgiv--------------------------------------------------
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  vgdevrvkvlgvdlekgrivlsl-----------------------------------------------
00511775   5/5  ----------------------------PfkgevveGtVvsvtkfgvfvdlg.gvegfvplselsddrvf
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  -----------------------------------GtVtsvtdfgafVdlgggveGlvhiselsddllll
00464514   4/5  kvlevdk---------------------------------------------------------------
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  ----------------------yeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels......
00385904   4/5  evdkerkgivlslkr-------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  lsvdpekg--------------------------------------------------------------
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  rvkvyvlevdkeskg-------------------------------------------------------
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  --------------------------kdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvsel
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLLPPPLPQEEERPRRARSGKERARRKGAPRREDRREYEY
00505753   3/5  ----------------------------------------------------------------------
00505755   5/5  edpeevlkvGdevkvkvlsvdpekgrisLSlkkall----------------------------------
00470193   3/5  ----------------------------------------------------------------------
00488875   5/5  edpedvlkvgdevevkvlevdkekgrivLSl---------------------------------------
00488874   4/5  ----------------------------------------------------------------------
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  deerlalvgedpsevlkvGdevevkvlevdlergeldllrivL---------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  edlsdvlkvgdevevkvlsvdkekgrivLSl---------------------------------------
00478285   5/5  edlsdvlkvgdevevkvlevdkekgrivLSl---------------------------------------
00521073   3/5  ----------------------------------------------------------------------
00406753   3/5  ----------------------------------------------------------------------
00406755   5/5  vedpsell.vGdevkvkvlevdkekgrivLslkkll----------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  ----------------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  leevlkvgdevkvkvlkvd.ekgrivLslkkl--------------------------------------
00521075   5/5  fdekllllvgedlelvlkvgdevrvkvlevdkeegrivl-------------------------------
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  ----------------------------------------------------------------------
00494275   5/5  llelslkrvedisdvlkvGqevlvkvlkvdlgnkgi----------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  dedenllvwedlelvlkvgdevrvkvlgvdlekgri----------------------------------
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  rvedlsdvlkvgdevevkvlevd-----------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  pgevlkvgdrvkvkvlevdkerkgivlslkr---------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  i......pgevlkvgdrvkvyvlevdkeskg---------------------------------------
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GAVAEYNLYDASSVPTTTATVKLGDLYGDLLASLGLEEEAEEKSRG------------------------
00505753   3/5  ----------------------------------------------------------------------
00505755   5/5  ----------------------------------------------------------------------
00470193   3/5  ----------------------------------------------------------------------
00488875   5/5  ----------------------------------------------------------------------
00488874   4/5  ----------------------------------------------------------------------
00505751   1/5  ----------------------------------------------------------------------
00488873   3/5  ----------------------------------------------------------------------
00470195   5/5  ----------------------------------------------------------------------
00470194   4/5  ----------------------------------------------------------------------
00517715   5/5  ----------------------------------------------------------------------
00478285   5/5  ----------------------------------------------------------------------
00521073   3/5  ----------------------------------------------------------------------
00406753   3/5  ----------------------------------------------------------------------
00406755   5/5  ----------------------------------------------------------------------
00517714   4/5  ----------------------------------------------------------------------
00478284   4/5  ----------------------------------------------------------------------
00406754   4/5  ----------------------------------------------------------------------
00511773   3/5  ----------------------------------------------------------------------
00517713   3/5  ----------------------------------------------------------------------
00478283   3/5  ----------------------------------------------------------------------
00494555   5/5  ----------------------------------------------------------------------
00521075   5/5  ----------------------------------------------------------------------
00494553   3/5  ----------------------------------------------------------------------
00521074   4/5  ----------------------------------------------------------------------
00494273   3/5  ----------------------------------------------------------------------
00494275   5/5  ----------------------------------------------------------------------
00494554   4/5  ----------------------------------------------------------------------
00494274   4/5  ----------------------------------------------------------------------
00470191   1/5  ----------------------------------------------------------------------
00470192   2/5  ----------------------------------------------------------------------
00488872   2/5  ----------------------------------------------------------------------
00511774   4/5  ----------------------------------------------------------------------
00511775   5/5  ----------------------------------------------------------------------
00488871   1/5  ----------------------------------------------------------------------
00517712   2/5  ----------------------------------------------------------------------
00478282   2/5  ----------------------------------------------------------------------
00406751   1/5  ----------------------------------------------------------------------
00406752   2/5  ----------------------------------------------------------------------
00464515   5/5  ----------------------------------------------------------------------
00464514   4/5  ----------------------------------------------------------------------
00385903   3/5  ----------------------------------------------------------------------
00385905   5/5  ----------------------------------------------------------------------
00385904   4/5  ----------------------------------------------------------------------
00464513   3/5  ----------------------------------------------------------------------
00517711   1/5  ----------------------------------------------------------------------
00505754   4/5  ----------------------------------------------------------------------
00478281   1/5  ----------------------------------------------------------------------
00494551   1/5  ----------------------------------------------------------------------
00494271   1/5  ----------------------------------------------------------------------
00477154   4/5  ----------------------------------------------------------------------
00521071   1/5  ----------------------------------------------------------------------
00521072   2/5  ----------------------------------------------------------------------
00494272   2/5  ----------------------------------------------------------------------
00477153   3/5  ----------------------------------------------------------------------
00385901   1/5  ----------------------------------------------------------------------
00477155   5/5  ----------------------------------------------------------------------
00494552   2/5  ----------------------------------------------------------------------
00511771   1/5  ----------------------------------------------------------------------
00511772   2/5  ----------------------------------------------------------------------
00385902   2/5  ----------------------------------------------------------------------
00477151   1/5  ----------------------------------------------------------------------
00505752   2/5  ----------------------------------------------------------------------
00464511   1/5  ----------------------------------------------------------------------
00464512   2/5  ----------------------------------------------------------------------
00477152   2/5  ----------------------------------------------------------------------