[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS82289.1


[Show Plain Result]

## Summary of Sequence Search
   1::223
  79::215  1.2e-50 50.4% 0037657 00376571 1/1   dopterin synthase subunit MoaE          
   2::79   6.8e-21 53.2% 0046810 00468101 1/1   ThiS                                    
   1::77   7.6e-21 57.1% 0050209 00502091 1/1   ThiS                                    
   3::79   6.9e-18 54.1% 0050092 00500921 1/1   ThiS                                    
   1::79   1.6e-15 44.3% 0050525 00505251 1/1   ThiS                                    
   7::79   1.7e-15 47.1% 0049256 00492561 1/1   ThiS                                    
   5::79   1.7e-11 45.7% 0049270 00492701 1/1   ThiS                                    
  13::79   5.2e-05 33.9% 0046674 00466741 1/1   ThiS                                    
   1::223


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
00376571   1/1  ----------------------------------------------------------------------
00468101   1/1  -kikvllfallrellgvdeeelelp.gatvadllelLalrypelaaallldlllvavngelvgldtplkd
00502091   1/1  mmkikvllfaalrellgvdeeelelpegatvgdlleaLaerypglaealldglgellsvvlvavNgelvg
00500921   1/1  --ikvllfaalrellgveelele...gatvgellealalrypglaelllddgelrrlvavavngelvrll
00505251   1/1  erlelllllelmkvkveffgglrllfgkekevlvtlpllsegatvgdLlelLaenlpglreelfvedgsl
00492561   1/1  ------ffallrellgvngeelelpegltvadllellglryplv.....avavNgeivprdtllkdgdev
00492701   1/1  ----vllfallrilvngeelelelpegltvadlleel.....gldlelvavavNgeivprdellkdgdel
00466741   1/1  ------------lkilvngeeleleegltvaellellgldlkl.....vavavNgeivprsewletllkd


                         -         -         *         -         -         -         -:140
query           AFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
00376571   1/1  --------aellvrltlepldlaellallaadpsaGAvvtFvGtvRdlndgkkvlaLeyeaypgmaekal
00468101   1/1  gdevalfPp-------------------------------------------------------------
00502091   1/1  ldtplkd---------------------------------------------------------------
00500921   1/1  dgldtplkd-------------------------------------------------------------
00505251   1/1  rpgilvlvN-------------------------------------------------------------
00492561   1/1  eilppvgGG-------------------------------------------------------------
00492701   1/1  eivppvgGG-------------------------------------------------------------
00466741   1/1  gdeleilpa-------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGS
00376571   1/1  eeiaeealerwplldvlvvhrlGllavgeaivlvavaaahRkeafealeflidrlKaevPiWKkelledg
00468101   1/1  ----------------------------------------------------------------------
00502091   1/1  ----------------------------------------------------------------------
00500921   1/1  ----------------------------------------------------------------------
00505251   1/1  ----------------------------------------------------------------------
00492561   1/1  ----------------------------------------------------------------------
00492701   1/1  ----------------------------------------------------------------------
00466741   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FWVEGFAPEDKRL---------------------------------------------------------
00376571   1/1  elWve-----------------------------------------------------------------
00468101   1/1  ----------------------------------------------------------------------
00502091   1/1  ----------------------------------------------------------------------
00500921   1/1  ----------------------------------------------------------------------
00505251   1/1  ----------------------------------------------------------------------
00492561   1/1  ----------------------------------------------------------------------
00492701   1/1  ----------------------------------------------------------------------
00466741   1/1  ----------------------------------------------------------------------