[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS82295.1


[Show Plain Result]

## Summary of Sequence Search
   1::225
  17::195  3.4e-11 27.0% 0051159 00511591 1/1   lo-dependent phosphatases               
  15::196  2.2e-10 29.3% 0049880 00498801 1/1   lo-dependent phosphatases               
  12::199  2.3e-10 26.2% 0053347 00533471 1/1   lo-dependent phosphatases               
  20::195    2e-08 30.6% 0051479 00514791 1/1   lo-dependent phosphatases               
  20::195  4.2e-08 26.7% 0051688 00516881 1/1   lo-dependent phosphatases               
  19::195  1.8e-07 33.6% 0049468 00494681 1/1   lo-dependent phosphatases               
  20::195  3.2e-07 30.3% 0043485 00434851 1/1   lo-dependent phosphatases               
  23::203  7.4e-07 29.7% 0051021 00510211 1/1   lo-dependent phosphatases               
  20::208  6.1e-05 24.6% 0037943 00379431 1/1   lo-dependent phosphatases               
   1::225


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVYARTPLSLRLFARMKRSVRLLVLSDQVHPHIHSPRFPENLPPFDLVLAAGDLPGAYLEYVATKVRVPV
00511591   1/1  ----------------lpsaddpmrilhisDlHggdgllallealleliekpDlvlilGDlvydrgvgdd
00498801   1/1  --------------lllmmmrilhisD...lHlgldaleallelandlgpDavvlaGDltdrgsvpaeya
00533471   1/1  -----------p.pgldgpmrilhisDlHlglaalerllelaireekpDlvlflGDlvdggppsedyrkl
00514791   1/1  -------------------mrilvisDlHlggnlaallellkellaelkpdlvlflGDlvdrgvlellke
00516881   1/1  -------------------mlmmkilviSDlHgnlralelleallellkalkvdlvihlGDlvdggvlel
00494681   1/1  ------------------pmrilvisDlHggldalerllellgalkpdlvlflGDlvdrgppslevlgll
00434851   1/1  -------------------mkilvisDlHggldalealldllreekvdlvihlGDlvdggplellrelgi
00510211   1/1  ----------------------nkiMlvisD.lHlgleepglsrgvdsplaalerllellnallekpdll
00379431   1/1  -------------------illkepnlleldmriaviGD.iHgqlddllallekigfdppvdllvflGDl


                         -         -         *         -         -         -         -:140
query           LFVPGNHGEEWVLEEGRRKRPGGVVNLHGRLFRHQGRLFYGIGGVPRYREGEGQLSEGELLRLALKPFPL
00511591   1/1  sleeldellellrklaagipvyvvpGNHDfdlgeyllkaaglealleplnl.pengpgtlgglyysleig
00498801   1/1  allellselgvpvlavpGNhDapllelllrllnplvlyrryillllepvvelgglrivglggslptpplt
00533471   1/1  ydevlellralkagvpvyvvlGNHDfdnglsleglrdflaelgfpvlpanvldgfgglyyvfeiggvriv
00514791   1/1  lgipvylvlGNHDf........................................................
00516881   1/1  lkalgipviavrGNhDfl.................................................lgl
00494681   1/1  fllllellkklgipvylvlGNH................................................
00434851   1/1  pvvavlGNhDfllllevlle............................................dilell
00510211   1/1  lllGDlvdrgpeslevlellral.gipvylvlGNHDfylglslll.........................
00379431   1/1  vdrgpdslevlrlllsl...pvilvrGNHelmllnalygfllevkwkylggletllllglg.........


                         +         -         -         -         -         *         -:210
query           AFPRRLLLGHGVDVLLTHAPPPGPSAGEDFAHRGARAFLLFHRLFRPRLHVHGHTPLLGANPERRHRTPL
00511591   1/1  gvriigldtrtygrlgd...............eqlewleeelaelrrsgapwiiv---------------
00498801   1/1  lrellgrlsaeqlewllkalaea........pdrptvlllHhppagt....ggahv--------------
00533471   1/1  vlggltprdddl...............dqlewlerelaelrasgadwvivlsHhppygs-----------
00514791   1/1  ..qlewleelllaaeglrillvHgpl.......ggllggaeallelleeygvdlv---------------
00516881   1/1  ellellallpeylvleigglkillvHghlldv.......lvdpeallalarelda---------------
00494681   1/1  ..dlllgdlleelldllpllalilgglrillvHgplspd..............ld---------------
00434851   1/1  dllpealvlelgglrilltHgpplpd.............llllarelgvdlvlfG---------------
00510211   1/1  .......................lewleellaaleldg.lvilltHgplypsldlllq..lga-------
00379431   1/1  .........aellkelldwlralplallvlvdggkillvHgglspsliepleeqlledllwsdplfge--


                         -         -         -         +         -         -         -:280
query           GVEVVHAQGYALIAL-------------------------------------------------------
00511591   1/1  ----------------------------------------------------------------------
00498801   1/1  ----------------------------------------------------------------------
00533471   1/1  ----------------------------------------------------------------------
00514791   1/1  ----------------------------------------------------------------------
00516881   1/1  ----------------------------------------------------------------------
00494681   1/1  ----------------------------------------------------------------------
00434851   1/1  ----------------------------------------------------------------------
00510211   1/1  ----------------------------------------------------------------------
00379431   1/1  ----------------------------------------------------------------------