[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : B0244.8
DDBJ      :             SR-famA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  73/199 : Viruses  0/175   --->[See Alignment]
g.12.1
:551 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   122->508 1n7dA PDBj 2e-35 43.8 %
:RPS:PDB   120->159 1d2jA PDBj 3e-04 40.0 %
:RPS:PDB   196->338 3brgC PDBj 3e-09 9.8 %
:RPS:PDB   396->527 3brgC PDBj 1e-06 8.8 %
:RPS:SCOP  122->168 1n7dA7  g.12.1.1 * 4e-04 34.0 %
:RPS:SCOP  215->262 1n7dA7  g.12.1.1 * 9e-06 34.8 %
:RPS:SCOP  291->331 1n7dAa  g.12.1.1 * 2e-05 34.1 %
:RPS:SCOP  426->460 1n7dAa  g.12.1.1 * 2e-04 30.6 %
:RPS:SCOP  454->495 1j8eA  g.12.1.1 * 2e-04 38.1 %
:HMM:SCOP  119->159 1f5yA2 g.12.1.1 * 6.8e-09 46.3 %
:HMM:SCOP  213->251 1cr8A_ g.12.1.1 * 3e-10 48.7 %
:HMM:SCOP  252->290 2gtlM2 g.12.1.1 * 1.2e-05 41.0 %
:HMM:SCOP  289->327 1n7dAa g.12.1.1 * 1.4e-06 41.0 %
:HMM:SCOP  378->416 1cr8A_ g.12.1.1 * 4.2e-07 35.9 %
:HMM:SCOP  418->455 1f5yA2 g.12.1.1 * 3.8e-05 39.5 %
:HMM:SCOP  456->506 1n7dA7 g.12.1.1 * 1.1e-08 36.0 %
:RPS:PFM   215->251 PF00057 * Ldl_recept_a 6e-04 51.4 %
:RPS:PFM   291->327 PF00057 * Ldl_recept_a 3e-04 51.4 %
:HMM:PFM   121->159 PF00057 * Ldl_recept_a 4.6e-11 51.4 37/37  
:HMM:PFM   190->212 PF00057 * Ldl_recept_a 1.1e-06 43.5 23/37  
:HMM:PFM   215->251 PF00057 * Ldl_recept_a 3.3e-13 50.0 36/37  
:HMM:PFM   252->287 PF00057 * Ldl_recept_a 1.2e-09 52.8 36/37  
:HMM:PFM   295->327 PF00057 * Ldl_recept_a 2.6e-08 48.5 33/37  
:HMM:PFM   372->413 PF00057 * Ldl_recept_a 3.4e-11 44.4 36/37  
:HMM:PFM   418->455 PF00057 * Ldl_recept_a 4.6e-09 45.7 35/37  
:HMM:PFM   457->493 PF00057 * Ldl_recept_a 5.3e-09 41.7 36/37  
:BLT:SWISS 119->159 ST14_HUMAN 8e-05 39.0 %
:BLT:SWISS 144->539 SORL_HUMAN 2e-52 36.7 %
:PROS 190->212|PS01209|LDLRA_1
:PROS 229->254|PS01209|LDLRA_1
:PROS 265->289|PS01209|LDLRA_1
:PROS 305->331|PS01209|LDLRA_1
:PROS 391->413|PS01209|LDLRA_1
:PROS 433->458|PS01209|LDLRA_1
:PROS 471->495|PS01209|LDLRA_1
:TM
:REPEAT 9|128->160|188->213|232->251|265->288|299->328|377->416|433->455|471->494|514->539

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAA68376.2 GT:GENE B0244.8 GT:PRODUCT SR-famA GT:ORG cele0 GT:DATABASE WS208 WP:CE CE32094 WP:PRODUCT SR-famA WP:LOCUS WBGene00015083 GB:PROTEIN_ID AAA68376.2 LENGTH 551 SQ:AASEQ MSQQPGSARRVNFPEEPMTLGEKFSHRMDQLKEIIADGGCSRAAKCVSITVCLVLLVLIFGGAIVYLVMSLTSSAQKMSADSMDISPQAIRHPKFWPPTDKIRFDDLNGIPMTSLFPQNVSTCSGFGFACTGAVHMVIPSSKRCDGRRDCEDGSDEENCKECQSVFSCKLRPEEESKKKGRSTVQPTLICLTAQHLCDNVENCPDGSDEAVCKSSCSKDQFKCPGSNACLPLSAKCDGINDCADASDEKNCSKCQNNAHKCGKQCIKASHVCDGVAQCADGSDEQQCDCQRCSGTDKALCDDGTCIMRTQVCDGKKDCTDGMDEEDCPGSCTIESFSPKLKMVTCSDGKQYTEAEACSGSFESCDHDCPNSKCHPKLAFTCPASKEARKMCISRRKVCDGTPDCDDGADEINCTPIKECGIAKNTQFKCDHKCLDSSRRCDGVWDCEDKSDEKGCDKCPSGTIKCAADKKCLPAFTRCNGVADCSDGSDELKCSCQECLGVHSNTYMCNESNRCLKRDEVCSPYSMCPNATYTDKAFCAALFLKKSGTSPF BL:SWS:NREP 2 BL:SWS:REP 119->159|ST14_HUMAN|8e-05|39.0|40/855| BL:SWS:REP 144->539|SORL_HUMAN|2e-52|36.7|373/2214| PROS 190->212|PS01209|LDLRA_1|PDOC00929| PROS 229->254|PS01209|LDLRA_1|PDOC00929| PROS 265->289|PS01209|LDLRA_1|PDOC00929| PROS 305->331|PS01209|LDLRA_1|PDOC00929| PROS 391->413|PS01209|LDLRA_1|PDOC00929| PROS 433->458|PS01209|LDLRA_1|PDOC00929| PROS 471->495|PS01209|LDLRA_1|PDOC00929| TM:NTM 1 TM:REGION 46->68| NREPEAT 1 REPEAT 9|128->160|188->213|232->251|265->288|299->328|377->416|433->455|471->494|514->539| BL:PDB:NREP 1 BL:PDB:REP 122->508|1n7dA|2e-35|43.8|297/639| RP:PDB:NREP 3 RP:PDB:REP 120->159|1d2jA|3e-04|40.0|38/40| RP:PDB:REP 196->338|3brgC|3e-09|9.8|143/414| RP:PDB:REP 396->527|3brgC|1e-06|8.8|117/414| RP:PFM:NREP 2 RP:PFM:REP 215->251|PF00057|6e-04|51.4|36/37|Ldl_recept_a| RP:PFM:REP 291->327|PF00057|3e-04|51.4|37/37|Ldl_recept_a| HM:PFM:NREP 8 HM:PFM:REP 121->159|PF00057|4.6e-11|51.4|37/37|Ldl_recept_a| HM:PFM:REP 190->212|PF00057|1.1e-06|43.5|23/37|Ldl_recept_a| HM:PFM:REP 215->251|PF00057|3.3e-13|50.0|36/37|Ldl_recept_a| HM:PFM:REP 252->287|PF00057|1.2e-09|52.8|36/37|Ldl_recept_a| HM:PFM:REP 295->327|PF00057|2.6e-08|48.5|33/37|Ldl_recept_a| HM:PFM:REP 372->413|PF00057|3.4e-11|44.4|36/37|Ldl_recept_a| HM:PFM:REP 418->455|PF00057|4.6e-09|45.7|35/37|Ldl_recept_a| HM:PFM:REP 457->493|PF00057|5.3e-09|41.7|36/37|Ldl_recept_a| RP:SCP:NREP 5 RP:SCP:REP 122->168|1n7dA7|4e-04|34.0|45/50|g.12.1.1| RP:SCP:REP 215->262|1n7dA7|9e-06|34.8|46/50|g.12.1.1| RP:SCP:REP 291->331|1n7dAa|2e-05|34.1|41/44|g.12.1.1| RP:SCP:REP 426->460|1n7dAa|2e-04|30.6|35/44|g.12.1.1| RP:SCP:REP 454->495|1j8eA|2e-04|38.1|41/44|g.12.1.1| HM:SCP:REP 119->159|1f5yA2|6.8e-09|46.3|41/41|g.12.1.1|1/9|LDL receptor-like module| HM:SCP:REP 213->251|1cr8A_|3e-10|48.7|39/42|g.12.1.1|3/9|LDL receptor-like module| HM:SCP:REP 252->290|2gtlM2|1.2e-05|41.0|39/0|g.12.1.1|4/9|LDL receptor-like module| HM:SCP:REP 289->327|1n7dAa|1.4e-06|41.0|39/44|g.12.1.1|5/9|LDL receptor-like module| HM:SCP:REP 378->416|1cr8A_|4.2e-07|35.9|39/42|g.12.1.1|6/9|LDL receptor-like module| HM:SCP:REP 418->455|1f5yA2|3.8e-05|39.5|38/41|g.12.1.1|7/9|LDL receptor-like module| HM:SCP:REP 456->506|1n7dA7|1.1e-08|36.0|50/50|g.12.1.1|8/8|LDL receptor-like module| OP:NHOMO 2020 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----621----3---------------------11------------------------------------------------------------------------1--*TZYfbVFDEDJNGgdFaIt*R2WNsDIDGRIJTKAJGEAWD9bGUIQSYm*frQQDXFGXXIYG----R------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 445 STR:RPRED 80.8 SQ:SECSTR ###############################################################################################TcTTcccccccEEEEEEEcccEEEEEccTTccccEEEEEccTTccccccccccEEEHHHHHHHHHHHHHHGGGTTTTcccccccHHHHHHHHHHHHTTTcGcccTTcEEEEEEccccccEEETTEEEEEccccccEEEEEcccccccccccccTTcEEEETTTcccccEEEEEETTEEEccccccccTTcEEEEEETTcccEEEEEETTEEEEEEcccccccTTEEEccGGGcEEEEEEEEEEEEccccccccccEEEEEEETTEEEEEEEEEEccccccccccccTTcHHHHccccccccccccccccccTTTHHHHcTTccEEEEEEEEEccccccccEEEEEEEEEEEccTTcccTTccEEEEccTTcTTcccccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHTTTHHcHHHHHGGGHHHH########### DISOP:02AL 1-15, 547-551| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHcccccHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEccccEEEEcccccccccccccccccccccccccccEEcccEEccccEEEcccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEcccccccccccccccccccccccccccccccccEEEcccEEEccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccEEEcccccccccccccc //