[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : B0250.5
DDBJ      :             3-HYDROXYISOBUTYRATE DEHYDROGENASE PRECURSOR (EC 1.1.1.31) (HIBADH) (FRAGMENT)
Swiss-Prot:3HIDH_CAEEL  RecName: Full=Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial;         Short=HIBADH;         EC=1.1.1.31;

Homologs  Archaea  25/68 : Bacteria  558/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->299 2gf2A PDBj 3e-88 54.9 %
:RPS:PDB   5->298 3ckyC PDBj 5e-69 37.1 %
:RPS:SCOP  5->163 1vpdA2  c.2.1.6 * 5e-39 39.2 %
:RPS:SCOP  165->297 3cumA1  a.100.1.1 * 5e-30 46.2 %
:HMM:SCOP  1->168 1pgjA2 c.2.1.6 * 4.8e-37 34.0 %
:HMM:SCOP  165->299 2cvzA1 a.100.1.1 * 4.3e-29 29.7 %
:RPS:PFM   5->164 PF03446 * NAD_binding_2 7e-22 39.7 %
:HMM:PFM   4->163 PF03446 * NAD_binding_2 1.4e-48 38.4 159/163  
:BLT:SWISS 1->299 3HIDH_CAEEL e-170 100.0 %
:PROS 6->19|PS00895|3_HYDROXYISOBUT_DH

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB03798.1 GT:GENE B0250.5 GT:PRODUCT 3-HYDROXYISOBUTYRATE DEHYDROGENASE PRECURSOR (EC 1.1.1.31) (HIBADH) (FRAGMENT) GT:ORG cele0 GT:DATABASE WS208 WP:CE CE18481 WP:PRODUCT 3-HYDROXYISOBUTYRATE DEHYDROGENASE PRECURSOR (EC 1.1.1.31) (HIBADH) (FRAGMENT) WP:LOCUS WBGene00007122 GB:PROTEIN_ID CAB03798.1 LENGTH 299 SQ:AASEQ MSLTGFIGLGNMGGHMARNLIKNGKKLIVYDVNKAVVQEFKAEGCEVAAHPADIAAASKEIITVLPSSPHVKAVYQGEAGIFKTIQPGTLCMDSSTIDQIVSLEVAQAAALLKAEYIDAPISGGVTGAQQATLTFMVGAGNDATFKRAEAVLSLMGKNIVNLGAVGNGTAAKICNNMLLGIQMVAVAETMNLGISMGLDAKALAGIVNTSSGRCWSSDTYNPVPGVIENIPSCRGYAGGFGTTLMAKDLSLAQNASTNTQAPTPMGSLAHQIYRILARDPQYQAKDFGVVYQFLKKQNS SW:ID 3HIDH_CAEEL SW:DE RecName: Full=Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial; Short=HIBADH; EC=1.1.1.31; SW:GN ORFNames=B0250.5; SW:KW Complete proteome; Mitochondrion; NAD; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->299|3HIDH_CAEEL|e-170|100.0|299/299| GO:SWS:NREP 3 GO:SWS GO:0005739|"GO:mitochondrion"|Mitochondrion| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 6->19|PS00895|3_HYDROXYISOBUT_DH|PDOC00697| BL:PDB:NREP 1 BL:PDB:REP 5->299|2gf2A|3e-88|54.9|293/296| RP:PDB:NREP 1 RP:PDB:REP 5->298|3ckyC|5e-69|37.1|286/296| RP:PFM:NREP 1 RP:PFM:REP 5->164|PF03446|7e-22|39.7|156/160|NAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 4->163|PF03446|1.4e-48|38.4|159/163|NAD_binding_2| GO:PFM:NREP 3 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| RP:SCP:NREP 2 RP:SCP:REP 5->163|1vpdA2|5e-39|39.2|158/161|c.2.1.6| RP:SCP:REP 165->297|3cumA1|5e-30|46.2|132/134|a.100.1.1| HM:SCP:REP 1->168|1pgjA2|4.8e-37|34.0|162/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 165->299|2cvzA1|4.3e-29|29.7|128/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1934 OP:NHOMOORG 756 OP:PATTERN ------1122222221-411111----1-1-------------1------1----1------11--11 123-121-------45421-13--271111115757247622281111----546222--1-1---42221-------1---3111-------------------1-2--------------------1--1----43332---13221-222----11112111-11111-111---1-11-12112---3121111122222222223222222222222221111111211-------------------2-2-22-1---11--221111122-1-------------------------------------------1-1-11-------1-1-1---11------111--33-----1---------2122222-----429972233532211231333224-12711A29452-466354686677762224342222657111111116--22111-----------------------------32242-385396776766222166AB55552574G9A75-4553343335286781221--1241111111111222-12--221111--2-2-21222-111111--11-------------111-11-----1121223-222322222223222222222222---1112------2211-114334454544-34444444243433444413342211-4244434444434344132122331--11111111111----1111-1111133531113-2--1-1111133333241123-55654554444453323-1-1--1-1-311211111332221132222222------2---1111--------1-1------------------1----------------1-1 ----111-421-11184552323432322222222222223222223222149622222222111----1--1-1------11111---11141211211111212-27345435322121222322426J2-33522212-2221222221241332322343211428211211242H131-355A75742275444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 299 STR:RPRED 100.0 SQ:SECSTR ccEEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTcTTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHHHHHTcccccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTcTTccGGGGHHHHHHHHH DISOP:02AL 298-300| PSIPRED ccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEccHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEcccccccHHHccccEEEEEccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcc //