[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : B0513.5
DDBJ      :             helicase
Swiss-Prot:PROD_CAEEL   RecName: Full=Proline dehydrogenase, mitochondrial;         EC=1.5.99.8;AltName: Full=Proline oxidase;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  73/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
a.39.1c.1.23
:616 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   284->372 2fotA PDBj 8e-04 22.5 %
:BLT:PDB   345->593 1tj1A PDBj 4e-07 25.5 %
:RPS:PDB   120->241 2dwuA PDBj 6e-04 17.2 %
:RPS:PDB   285->335 1aj5A PDBj 5e-04 7.8 %
:RPS:PDB   345->580 2ekgB PDBj 3e-47 22.5 %
:RPS:SCOP  285->338 1k9uA  a.39.1.10 * 7e-05 26.4 %
:RPS:SCOP  345->593 1k87A2  c.1.23.2 * 3e-54 24.7 %
:HMM:SCOP  126->605 1k87A2 c.1.23.2 * 2.5e-91 37.7 %
:RPS:PFM   345->590 PF01619 * Pro_dh 3e-48 43.9 %
:HMM:PFM   243->594 PF01619 * Pro_dh 1.4e-126 40.4 339/345  
:HMM:PFM   112->147 PF09875 * DUF2102 5.5e-05 45.7 35/104  
:BLT:SWISS 1->616 PROD_CAEEL 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB05117.2 GT:GENE B0513.5 GT:PRODUCT helicase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE37309 WP:PRODUCT helicase WP:LOCUS WBGene00007197 GB:PROTEIN_ID CAB05117.2 LENGTH 616 SQ:AASEQ MQAALIGLNFPLQRRFLSGVLTTTSSAKRCYSGDTGKPYDCTSAEHKKELEECYNRLDLSFENTKEAFKSKSNTELVRALVVLRLCGIQTLVNQNQIILNTMRRVLGKNLFKKTLKNTFFGHFVAGETEEEVRHVVEKLRNYGVKSILDYSVEADITSQEATDKTVKGTSVATVKPAAMTPVVDAKTLETTRERYTVHEEFGDRRQGVSSARTYFYEGEEQCDKNRDIFKDSINAVASATKNEGFVAVKITALGRPQLLLKLSEAIVQTQNFFKALTGGMSLQEGRLTSQEFYKRLGELGVKTDTESVKKFFDEVDFDSDGIVDLHGWNHILDDHVKLGQLFQVLNIKTGSLEPLIQNLSNEEEQEFRNMVRRTLDVAEYAIEKGVRIMVDAEQTYLQPAISKITIEMMKKYNKGRGNIFNTYQAYLKGTLQNMEADMQVARREGWHFGAKLVRGAYMEQERARAKAIGYEDPINDNFEATSKMYESCLTRIADEVHRRGKTNVSVMVASHNEDTVRFALNLMKEKCISPSERVMCMAQLYGMCDQVSFSLGQAGFSVYKYLPYGPVEEVLPYLSRRALENGSVLKKANKERDLLWKELKRRISSGEFKARSSSSS SW:ID PROD_CAEEL SW:DE RecName: Full=Proline dehydrogenase, mitochondrial; EC=1.5.99.8;AltName: Full=Proline oxidase;Flags: Precursor; SW:GN ORFNames=B0513.5; SW:KW Complete proteome; FAD; Flavoprotein; Mitochondrion; Oxidoreductase;Proline metabolism; Transit peptide. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->616|PROD_CAEEL|0.0|100.0|616/616| GO:SWS:NREP 4 GO:SWS GO:0005739|"GO:mitochondrion"|Mitochondrion| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006560|"GO:proline metabolic process"|Proline metabolism| BL:PDB:NREP 2 BL:PDB:REP 284->372|2fotA|8e-04|22.5|89/134| BL:PDB:REP 345->593|1tj1A|4e-07|25.5|239/450| RP:PDB:NREP 3 RP:PDB:REP 120->241|2dwuA|6e-04|17.2|116/265| RP:PDB:REP 285->335|1aj5A|5e-04|7.8|51/173| RP:PDB:REP 345->580|2ekgB|3e-47|22.5|200/298| RP:PFM:NREP 1 RP:PFM:REP 345->590|PF01619|3e-48|43.9|239/329|Pro_dh| HM:PFM:NREP 2 HM:PFM:REP 243->594|PF01619|1.4e-126|40.4|339/345|Pro_dh| HM:PFM:REP 112->147|PF09875|5.5e-05|45.7|35/104|DUF2102| GO:PFM:NREP 4 GO:PFM GO:0004657|"GO:proline dehydrogenase activity"|PF01619|IPR002872| GO:PFM GO:0006537|"GO:glutamate biosynthetic process"|PF01619|IPR002872| GO:PFM GO:0006562|"GO:proline catabolic process"|PF01619|IPR002872| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01619|IPR002872| RP:SCP:NREP 2 RP:SCP:REP 285->338|1k9uA|7e-05|26.4|53/76|a.39.1.10| RP:SCP:REP 345->593|1k87A2|3e-54|24.7|239/351|c.1.23.2| HM:SCP:REP 126->605|1k87A2|2.5e-91|37.7|310/0|c.1.23.2|1/1|FAD-linked oxidoreductase| OP:NHOMO 417 OP:NHOMOORG 254 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------1-----111111111-1------------------------1-----------111-111-1--------11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------11-------------------------11---------------------------------------------------------------------------1------------------------------1----1---1-111-----1-----------1---------------------------11---------1-----------1----------11----------1---------------------------------------1------------------------------------------1-----------11------------------------1----------------1-------------1111-11111111111-1-11---------------------------------------------------------------1-- ----111-211-11121223222332322222222222221221112212337432111111111111--11111-111111111111-12111111221111222-13172232222111112221238V21414111141211-211112-121122--52222382121121123--11113311222121111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 497 STR:RPRED 80.7 SQ:SECSTR #################################################################################################HHHHHTcHHHHHHHHHHcH#HHHHHHcccccHHHHHHHHHHHHHTTcEEEEEEEccccccHHHHccccEEEcHHHHHHHHHHHEEEEEEcHHHHHTTHHHHHHHcTTcEEEEEEcTTH###HHHHHTTcHcTTcHHHHHHHHHHcccHHHHHHHHHTccEEEEEEcHHHHHHHTHHHHHTTT#cccccEEcHHHHHHHHHHHHccHHHHHHHHHTccGGGGGGccccEEEEccccccccHHHHHHHHccEEEEEGGGGTTTTcHHHHHHHHHHHHHHHHHHGHHHGGTEEEEEccccGGGHHHHHHHHHHHHHTTccccccEEEEEETTcTTHHHHHTHHHHHHHHGGGcccEEEEcccccccHHHHHHHHTcTTTccccHHHHHHHHHHHHHHHHHHTccEE###EEEEEEcccHHHHHHHHHHHHHTTccGGGEEEEEEEETTccHHHHHHHHHTTccEEEEEEEccGTTHHHHHHHHHTcHHcTTcHHHHTTTccHHHHTcc############## DISOP:02AL 1-2, 41-57, 178-197, 612-616| PSIPRED cccEEEEcccHHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccEEEEEEcccccEEEEccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccEEEccccccHHHHHHHHHHHHcccccccccHHHHHHccccHHcccccccccccccccHHHHHccccHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccc //