[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C01A2.7
DDBJ      :             S.pombe hypothetical protein C1D4.09C like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 28->101 PTSP_BOMMO 6e-07 27.4 %
:TM
:REPEAT 3|28->37|53->62|92->101
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAD24480.1 GT:GENE C01A2.7 GT:PRODUCT S.pombe hypothetical protein C1D4.09C like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE30236 WP:PRODUCT S.pombe hypothetical protein C1D4.09C like WP:LOCUS WBGene00007219 GB:PROTEIN_ID CAD24480.1 LENGTH 101 SQ:AASEQ MQLIHFIVGLAMLISLSLAASDDRVLGWNKAHGLWGKRSVQEASQDKRTPQNWNKLNSLWGKRSASSFDDDYTTENGDDDVTMLYKRSPAQWQRANGLWGR BL:SWS:NREP 1 BL:SWS:REP 28->101|PTSP_BOMMO|6e-07|27.4|73/274| TM:NTM 1 TM:REGION 2->23| NREPEAT 1 REPEAT 3|28->37|53->62|92->101| SEG 10->21|lamlislslaas| SEG 69->80|dddyttengddd| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 38-52| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccEEHEEcccccHHHHccccccc //