[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C02B10.5
DDBJ      :             Eukaryotic protein kinase domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:698 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAB92020.1 GT:GENE C02B10.5 GT:PRODUCT Eukaryotic protein kinase domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE16802 WP:PRODUCT Eukaryotic protein kinase domain WP:LOCUS WBGene00015330 GB:PROTEIN_ID AAB92020.1 LENGTH 698 SQ:AASEQ MPASSTSSPSSKEEDEKHTSADEDVTPTASPSLVKSEVVKEEENDDADRTLTMPSTSQDIQPESSPAHGRSAPSSQEITSPPTVRRVATPLEAAEQEYYYFTTDMINQAALDIEREKEKFDSLITWYKLQRDDVPALGTSSVGNSTAPSYVSEKGSTTPMSSQPSSHQSGTSSTNGAHGGLNGFSCSPFGLENNPRSNDPMQCMSSPVELDEICPTLEDFMSSAASSSTPSTSSAPQMNQNQNTHPNSINHHHQPDTSLLMLNNHHSSPLNQLSFNHQMPSTSNSNPPSNASLKRRATEEFGNDGPMKQAKIEGSENDNNPMRKLEMMANSSNFRGGNTINEVVEASKKDERTLKMEKLDVIGKSVGEEFAQQAREAQMRQMQQAAAAAGSMPPSYPSPGQYPGPMHYPGMPPMMPPGAPFSAGASYPPMGGPFPPNPYGMHPGMTPGGYPMSAPGKMPFGSPSFPQSAPSPAAMAAMQQGRMPGPPMPPHMMTPQQQQHFMQMQQAQMAHFNAQKAAAAAAAAGMSPAARASPMGASPSPHHPHPSQFPPNHPANPMYHHHIMMMRAMHAQGGQPGHPGMMPPGMMPPGMMPPGMMPPGMHPGMAGMPPMHPGMQGMPPMHPGMQGMPGMPHGPPQPPQNPALMVAGNRAGSAEAAAAQMGNPHHPMMGANMWQLTPHYPPPLPASSSSGAGTPVSR SEG 4->11|sstsspss| SEG 34->43|vksevvkeee| SEG 155->174|gsttpmssqpsshqsgtsst| SEG 222->236|ssaassstpstssap| SEG 280->292|pstsnsnppsnas| SEG 371->441|aqqareaqmrqmqqaaaaagsmppsypspgqypgpmhypgmppmmppgapfsagasyppmggpfppnpygm| SEG 459->554|pfgspsfpqsapspaamaamqqgrmpgppmpphmmtpqqqqhfmqmqqaqmahfnaqkaaaaaaaagmspaaraspmgaspsphhphpsqfppnhp| SEG 558->640|myhhhimmmramhaqggqpghpgmmppgmmppgmmppgmmppgmhpgmagmppmhpgmqgmppmhpgmqgmpgmphgppqppq| SEG 647->662|agnragsaeaaaaqmg| SEG 681->697|ppplpassssgagtpvs| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24, 56-83, 149-177, 220-323, 326-698| PSIPRED cccccccccccHHHHHHHccccccccccccccHHHHHHHHcccccccccEEEcccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccccccccccccccccccHHccccccccccccccccccccccHHHHccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //