[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C02B8.6
DDBJ      :             DNA repair protein RAD16 (yeast, weak)
Swiss-Prot:YWZ6_CAEEL   RecName: Full=Uncharacterized RING finger protein C02B8.6;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.289.1g.44.1
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->45 2d8tA PDBj 7e-07 47.5 %
:BLT:PDB   231->310 1ujrA PDBj 1e-08 32.9 %
:RPS:PDB   5->56 3eb6A PDBj 8e-09 22.9 %
:RPS:PDB   241->323 2a90A PDBj 2e-10 18.5 %
:RPS:SCOP  3->57 1fbvA4  g.44.1.1 * 1e-09 18.2 %
:RPS:SCOP  231->310 1ujrA  d.289.1.1 * 7e-12 27.8 %
:HMM:SCOP  4->50 1v87A_ g.44.1.1 * 9.6e-09 31.9 %
:HMM:SCOP  227->341 1ujrA_ d.289.1.1 * 1.8e-24 26.4 %
:RPS:PFM   258->310 PF02825 * WWE 7e-04 26.4 %
:HMM:PFM   250->321 PF02825 * WWE 3.3e-24 25.4 71/72  
:HMM:PFM   5->43 PF00097 * zf-C3HC4 7.2e-07 25.6 39/42  
:HMM:PFM   38->86 PF02620 * DUF177 0.0004 24.5 49/119  
:BLT:SWISS 1->347 YWZ6_CAEEL 0.0 100.0 %
:PROS 20->29|PS00518|ZF_RING_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAA81439.2 GT:GENE C02B8.6 GT:PRODUCT DNA repair protein RAD16 (yeast, weak) GT:ORG cele0 GT:DATABASE WS208 WP:CE CE29656 WP:PRODUCT DNA repair protein RAD16 (yeast, weak) WP:LOCUS WBGene00015324 GB:PROTEIN_ID AAA81439.2 LENGTH 347 SQ:AASEQ MTDICTICHNTPNRPVRLDCNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVCLKGDAPRDVDDDEEEVQDEEIDVKPDVNLLRAAMNANQNGNRELVAAAPHMNNNGNFHNAQGNYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPVFAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTAAQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYILDFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD SW:ID YWZ6_CAEEL SW:DE RecName: Full=Uncharacterized RING finger protein C02B8.6; SW:GN ORFNames=C02B8.6; SW:KW Complete proteome; Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->347|YWZ6_CAEEL|0.0|100.0|347/347| GO:SWS:NREP 1 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 20->29|PS00518|ZF_RING_1|PDOC00449| SEG 68->83|dvdddeeevqdeeidv| SEG 112->123|nnngnfhnaqgn| BL:PDB:NREP 2 BL:PDB:REP 5->45|2d8tA|7e-07|47.5|40/71| BL:PDB:REP 231->310|1ujrA|1e-08|32.9|79/110| RP:PDB:NREP 2 RP:PDB:REP 5->56|3eb6A|8e-09|22.9|48/64| RP:PDB:REP 241->323|2a90A|2e-10|18.5|81/155| RP:PFM:NREP 1 RP:PFM:REP 258->310|PF02825|7e-04|26.4|53/70|WWE| HM:PFM:NREP 3 HM:PFM:REP 250->321|PF02825|3.3e-24|25.4|71/72|WWE| HM:PFM:REP 5->43|PF00097|7.2e-07|25.6|39/42|zf-C3HC4| HM:PFM:REP 38->86|PF02620|0.0004|24.5|49/119|DUF177| RP:SCP:NREP 2 RP:SCP:REP 3->57|1fbvA4|1e-09|18.2|55/79|g.44.1.1| RP:SCP:REP 231->310|1ujrA|7e-12|27.8|79/110|d.289.1.1| HM:SCP:REP 4->50|1v87A_|9.6e-09|31.9|47/0|g.44.1.1|1/1|RING/U-box| HM:SCP:REP 227->341|1ujrA_|1.8e-24|26.4|110/0|d.289.1.1|1/1|WWE domain| OP:NHOMO 7 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2------------------------------------------------------------23-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 44.7 SQ:SECSTR cEHcccccccccccEEEETTccEEEcTTTGGGccTTccccccccccccEEEEccccEEcccG########################################################################################################################################################################ccccccccccEEEcTTcHHHHTEEEEEEcccccccccEEEccHHHHHHHHHHHTTccEEEHHTccccEEEETTTTEEEETTTccccEEEEEEE######################## DISOP:02AL 65-88, 90-122, 212-237, 239-250| PSIPRED cccccHHHHHHccccEEEcccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHcccccccccccccHHHHccccHHHHccccccccccccccccccccccHHHccccccccHHHcccccHHHccccccccccccccccccccccHHHHHHHHHccccEEEEEEEcccccEEEccHHHHHHHHHHHcccccEEEEEcccEEEEEHHHHHHHccccHHHHHHHHHHHccccccccccEEEEEEEccEEEcc //