[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C03E10.6
DDBJ      :             serine\/threonine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.169.1
:252 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  76->247 1tdqB_ d.169.1.1 * 3.8e-07 23.4 %
:HMM:PFM   43->70 PF01391 * Collagen 1.4e-07 60.7 28/60  
:BLT:SWISS 74->186 YNQ8_CAEEL 3e-05 28.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB03825.2 GT:GENE C03E10.6 GT:PRODUCT serine\/threonine kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE40829 WP:PRODUCT serine\/threonine kinase WP:LOCUS WBGene00007283 GB:PROTEIN_ID CAB03825.2 LENGTH 252 SQ:AASEQ MIYRIVFFVVLFPALMECYRSHHSDDIVYYPDSYESEIRYIPGPPGKPGPPGRAGNYGQPGSQGPIGPPGSSSCNYECPPGYYSTSRNNAGIEHAWCIKMRSTAKTFNSNLFVNLDIECKKEGDVLTGFQNYTEFKAVYDKFKSSLSSVINVNKMPMILIGARRKDECTKIRQPECTSINGNQWTDGVTNGKNFFESPGFFAQQQPSPGSGTKMCFGIWTATKKLYSYKCTESDTNKPAKLIMCGKPAPCVF BL:SWS:NREP 1 BL:SWS:REP 74->186|YNQ8_CAEEL|3e-05|28.4|109/211| SEG 42->52|pgppgkpgppg| SEG 58->73|gqpgsqgpigppgsss| HM:PFM:NREP 1 HM:PFM:REP 43->70|PF01391|1.4e-07|60.7|28/60|Collagen| HM:SCP:REP 76->247|1tdqB_|3.8e-07|23.4|124/126|d.169.1.1|1/1|C-type lectin-like| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 16-68,75-90| PSIPRED cEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcHHccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEEcccccEEEEcccccccccccEEEEcccccccc //