[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C08B11.5
DDBJ      :             Zinc finger, C2H2 type
Swiss-Prot:SF3B4_CAEEL  RecName: Full=Splicing factor 3B subunit 4;AltName: Full=Spliceosome-associated protein 49;

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:388 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->96 1x5uA PDBj 1e-42 78.9 %
:BLT:PDB   106->178 1x5tA PDBj 3e-33 84.9 %
:RPS:PDB   12->178 1b7fA PDBj 2e-27 23.0 %
:RPS:SCOP  8->186 1u1kA  d.58.7.1 * 1e-26 22.0 %
:HMM:SCOP  11->186 1u1qA_ d.58.7.1 * 2.1e-44 42.5 %
:RPS:PFM   15->84 PF00076 * RRM_1 7e-12 45.7 %
:RPS:PFM   102->172 PF00076 * RRM_1 2e-13 48.6 %
:HMM:PFM   15->85 PF00076 * RRM_1 2.7e-19 42.9 70/70  
:HMM:PFM   102->172 PF00076 * RRM_1 1.2e-21 50.7 69/70  
:BLT:SWISS 1->260 SF3B4_CAEEL e-151 100.0 %
:REPEAT 2|8->89|93->177
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB60993.2 GT:GENE C08B11.5 GT:PRODUCT Zinc finger, C2H2 type GT:ORG cele0 GT:DATABASE WS208 WP:CE CE36374 WP:PRODUCT Zinc finger, C2H2 type WP:LOCUS WBGene00004723 GB:PROTEIN_ID CAB60993.2 LENGTH 388 SQ:AASEQ MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYAIKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGTSKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQVFSDVPLGVPANTPLAMPGVHAAIAAHATGRPGYQPPPLMGMAQSGYQGQYPPVPPPPPSVTPMPPPMPPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPPS SW:ID SF3B4_CAEEL SW:DE RecName: Full=Splicing factor 3B subunit 4;AltName: Full=Spliceosome-associated protein 49; SW:GN Name=sap-49; ORFNames=C08B11.5; SW:KW Complete proteome; mRNA processing; mRNA splicing; Nucleus; Repeat;RNA-binding; Spliceosome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->260|SF3B4_CAEEL|e-151|100.0|260/388| GO:SWS:NREP 5 GO:SWS GO:0006397|"GO:mRNA processing"|mRNA processing| GO:SWS GO:0008380|"GO:RNA splicing"|mRNA splicing| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0005681|"GO:spliceosomal complex"|Spliceosome| NREPEAT 1 REPEAT 2|8->89|93->177| SEG 261->387|ppvpppppsvtpmpppmpptpgmtprpppppssgmwppppppppgrtpgppgmpgmppppppsrfgppgmggmppppppgmrypggmpppppprypsagpgmypppppsrppappsghgmipppppp| BL:PDB:NREP 2 BL:PDB:REP 2->96|1x5uA|1e-42|78.9|95/105| BL:PDB:REP 106->178|1x5tA|3e-33|84.9|73/96| RP:PDB:NREP 1 RP:PDB:REP 12->178|1b7fA|2e-27|23.0|165/167| RP:PFM:NREP 2 RP:PFM:REP 15->84|PF00076|7e-12|45.7|70/71|RRM_1| RP:PFM:REP 102->172|PF00076|2e-13|48.6|70/71|RRM_1| HM:PFM:NREP 2 HM:PFM:REP 15->85|PF00076|2.7e-19|42.9|70/70|RRM_1| HM:PFM:REP 102->172|PF00076|1.2e-21|50.7|69/70|RRM_1| GO:PFM:NREP 2 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 8->186|1u1kA|1e-26|22.0|177/183|d.58.7.1| HM:SCP:REP 11->186|1u1qA_|2.1e-44|42.5|174/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 3229 OP:NHOMOORG 224 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------1---------------1-----------------1--111-1--1----------1-1-11--------11-1------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------11----31-------------------------1------1------------------------1--1------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- 55449691F5517898888886988956588589877747567777756767786677677795576755754666636566665586-47486854445474EEH2765MrlRUfbEHGJJQL**F*G**m-yb*DIGEtFPgQDOKGHTFCvFRIMNHRhKEACD*CNFIOBB1565h4748ASSrx7kJ3376644 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 53.9 SQ:SECSTR cccccccccccccEEEEEcccTTccHHHHHHHHHTTccEEEEEccEETTTTEEccEEEEEEccHHHHHHHHHHHTTcEETTEEcEEEEccccccTTTTcEEEEEcccTTccHHHHHHHHTccccEEHTEEEEEEcTTTccEEEEEEEEEccHHHHHHHHHHHTTcccTTcccccEEEEccccTTTcccccccccccccccccccccccc################################################################################################################################################################################### DISOP:02AL 1-11, 86-101, 240-388| PSIPRED cccccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHHccEEEccEEEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccccccccEEEEEEccHHHHHHHHHHHccEEEccEEEEEEEccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //