[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C17F4.3
DDBJ      :             YL-1 protein like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAK31436.1 GT:GENE C17F4.3 GT:PRODUCT YL-1 protein like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE08276 WP:PRODUCT YL-1 protein like WP:LOCUS WBGene00015911 GB:PROTEIN_ID AAK31436.1 LENGTH 257 SQ:AASEQ MRSYFLIFILILLLEIREVWSWKAPYLRDRPRGLGLLQLPTGISDERSGPFLPGLYIAGNKVNQKPQTVPDVHLPGQPADFTGRSAFNPFTHMVSAVYAEDLSDGWGAGMAVNGVNGHGLNVRKNFDSYADVPLNLNDGMYQPFIAAATVGGEYDLSKMREVSGSLDLPIPGVNELFDLNARILVKTFLLHNSAIEFPLTLSDPNERAPYNFRYAVWAPDRHMAYGHVVPNVNPYVIGKDKIMERLMQNRLNPTMVG SEG 5->14|flifililll| OP:NHOMO 9 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------45-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 257-258| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccccEEEEcccccccccccccccccccccccccccccccHHEEEEEEEEccccccccccEEEcccccccccccccHHHHcccccccccccccHHHHHEEccccccHHHEEEEEEEEccccccHHHHHcccccEEEEcccEEcccccccEEcccccccccccHHHHHHccccccHHHHccccccEEEEcHHHHHHHHHHccccccccc //