[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C24F3.6
DDBJ      :             Dual specificity phosphatase, catalytic domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   232->271 1af0A PDBj 1e-04 17.5 %
:RPS:PFM   13->50 PF01484 * Col_cuticle_N 4e-09 47.4 %
:HMM:PFM   95->123 PF01391 * Collagen 2.6e-07 51.7 29/60  
:HMM:PFM   12->63 PF01484 * Col_cuticle_N 6.2e-19 36.5 52/53  
:BLT:SWISS 3->92,272->291 CUC3A_HAECO 1e-22 58.6 %
:BLT:SWISS 95->122,230->277 COL90_CAEEL 4e-11 52.1 %
:TM
:REPEAT 4|98->109|110->121|244->255|256->267
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB97232.1 GT:GENE C24F3.6 GT:PRODUCT Dual specificity phosphatase, catalytic domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE18523 WP:PRODUCT Dual specificity phosphatase, catalytic domain WP:LOCUS WBGene00000698 GB:PROTEIN_ID CAB97232.1 LENGTH 291 SQ:AASEQ MDIDSRIKAYRFVGYAALTFSTIAVLSVCITLPMMYNYIHHTRKVMHSDIVECKSEAQRLFSQVNRIPDLMMAHNRTARQAGEGNGQCEGCCLPGAQGPPGTPGSAGRPGKPGAPGLNGNPGRPPKEPCEPLTPPPCKPCPEGPPGPAGPPGPDGNKGPLGPPGPPGPEGPNGEPGNKGPAGPPGPGGKPGPAGPPGENGNNGEPQPGAPGEPGQPGQPGQRGPAGEPGKDGSPGGQGEKGASGEPGQPGRDGQPGHPGQPGKDGRPGEKGVCPKYCALDGGVFFEDGHRR BL:SWS:NREP 2 BL:SWS:REP 3->92,272->291|CUC3A_HAECO|1e-22|58.6|107/295| BL:SWS:REP 95->122,230->277|COL90_CAEEL|4e-11|52.1|76/305| TM:NTM 1 TM:REGION 15->37| NREPEAT 1 REPEAT 4|98->109|110->121|244->255|256->267| SEG 124->229|ppkepcepltpppckpcpegppgpagppgpdgnkgplgppgppgpegpngepgnkgpagppgpggkpgpagppgengnngepqpgapgepgqpgqpgqrgpagepg| RP:PDB:NREP 1 RP:PDB:REP 232->271|1af0A|1e-04|17.5|40/470| RP:PFM:NREP 1 RP:PFM:REP 13->50|PF01484|4e-09|47.4|38/53|Col_cuticle_N| HM:PFM:NREP 2 HM:PFM:REP 95->123|PF01391|2.6e-07|51.7|29/60|Collagen| HM:PFM:REP 12->63|PF01484|6.2e-19|36.5|52/53|Col_cuticle_N| GO:PFM:NREP 1 GO:PFM GO:0042302|"GO:structural constituent of cuticle"|PF01484|IPR002486| OP:NHOMO 63 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------Qa-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 40 STR:RPRED 13.7 SQ:SECSTR #######################################################################################################################################################################################################################################TccccEEEcTTccccEEEccccccEEEccccccEEEcccc#################### DISOP:02AL 1-3, 63-272, 281-291| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //