[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C34G6.2
DDBJ      :             Ubiquitin carboxyl-terminal hydrolases family 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
a.86.1
:751 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   108->320 2zmxA PDBj 2e-29 41.3 %
:BLT:PDB   291->334 3ixvA PDBj 1e-04 38.6 %
:RPS:PDB   109->378 1bt1A PDBj 2e-22 18.0 %
:RPS:PDB   458->655 3cu7A PDBj 2e-06 4.5 %
:RPS:SCOP  109->380 1js8A1  a.86.1.1 * 6e-31 21.0 %
:HMM:SCOP  59->382 1bt3A_ a.86.1.2 * 3.7e-61 30.7 %
:RPS:PFM   153->320 PF00264 * Tyrosinase 3e-21 40.1 %
:RPS:PFM   457->492 PF01549 * ShK 4e-04 44.7 %
:RPS:PFM   502->536 PF01549 * ShK 1e-04 45.9 %
:RPS:PFM   611->645 PF01549 * ShK 7e-05 51.4 %
:RPS:PFM   636->679 PF12280 * BSMAP 8e-04 31.8 %
:HMM:PFM   137->320 PF00264 * Tyrosinase 4.6e-36 29.5 183/228  
:HMM:PFM   457->492 PF01549 * ShK 2.3e-09 41.7 36/38  
:HMM:PFM   502->536 PF01549 * ShK 2.7e-11 40.0 35/38  
:HMM:PFM   567->602 PF01549 * ShK 6.2e-08 38.9 36/38  
:HMM:PFM   611->645 PF01549 * ShK 2.6e-11 40.0 35/38  
:BLT:SWISS 1->657 TYR3_CAEEL 0.0 55.3 %
:PROS 154->171|PS00497|TYROSINASE_1
:PROS 302->313|PS00498|TYROSINASE_2
:REPEAT 4|450->492|494->536|558->602|604->645
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAB52481.1 GT:GENE C34G6.2 GT:PRODUCT Ubiquitin carboxyl-terminal hydrolases family 2 GT:ORG cele0 GT:DATABASE WS208 WP:CE CE08574 WP:PRODUCT Ubiquitin carboxyl-terminal hydrolases family 2 WP:LOCUS WBGene00016419 GB:PROTEIN_ID AAB52481.1 LENGTH 751 SQ:AASEQ MRFLIPIIFTTLPLCLQAQEDPCASAPSEAAKIMCKQIHRWDDGARAASKKKKIALPPGMAKGMAAEFAPIASNIYQCMDLPCLCSYLRGTASGNGCTLPNGRPLQKSVRKEYRTLTDDERNRLHAAFRALKNNGEYERIGRIHSQMSAAGGAHSGPAFLPWHREFVKRVEFALRQVDPTVNLPYWDSTLDSRLPRPADTIMFSDYLMGSTGLVNDGPFTNWRTLAGRAQILRAVGAQGAPLSQNDIDFVMRQTQIDQVLSFTAPQQGCPYRTDFNCLEYTHGNVHIFVGGDMFDTATSSNDPSFFLHHAFIDFVWEEWRLARQSRADREIAFPPDNQLCASAQHFGASPMQPFSPMRNIDGLSNKYTDNLYSYAPRPTCQAGGDCGSKFLFCDTSTGAARCVSRIRPGSQCGQFRVNPCFSGICQNGVCVLSSTAPRPTPAPTTPTPQNPVQSQESCFNENQCCASWAASGECSRNTAYMNEWCKASCGVCKPKYRLADDCTDRHTQCSSWSRSGECTKNQLWMTENCRKSCNKCGRSRAQECGGGGTTVTTTTPAPAQQCDNSDGCFNENVCCAVWGLMGECRKNTRYMACNCRVSCGHCYPEDYNYGSCVDYHRSCAGWARVGECQKNPWMAENCRSSCNSCYTQSELRRMCGTTAGSVAPVAQVRQTNPSRQPPRGGWGRDDFGDNGGWGGNGGGGWGNNDPWGGSRWGGGRGGWGGGGWGGGGWGKRSIRAANASISMPSFDPDLL BL:SWS:NREP 1 BL:SWS:REP 1->657|TYR3_CAEEL|0.0|55.3|651/693| PROS 154->171|PS00497|TYROSINASE_1|PDOC00398| PROS 302->313|PS00498|TYROSINASE_2|PDOC00398| NREPEAT 1 REPEAT 4|450->492|494->536|558->602|604->645| SEG 435->448|taprptpapttptp| SEG 545->555|ggggttvtttt| SEG 680->730|ggwgrddfgdnggwggnggggwgnndpwggsrwgggrggwggggwggggwg| BL:PDB:NREP 2 BL:PDB:REP 108->320|2zmxA|2e-29|41.3|201/277| BL:PDB:REP 291->334|3ixvA|1e-04|38.6|44/626| RP:PDB:NREP 2 RP:PDB:REP 109->378|1bt1A|2e-22|18.0|261/336| RP:PDB:REP 458->655|3cu7A|2e-06|4.5|198/1625| RP:PFM:NREP 5 RP:PFM:REP 153->320|PF00264|3e-21|40.1|157/205|Tyrosinase| RP:PFM:REP 457->492|PF01549|4e-04|44.7|36/38|ShK| RP:PFM:REP 502->536|PF01549|1e-04|45.9|35/38|ShK| RP:PFM:REP 611->645|PF01549|7e-05|51.4|35/38|ShK| RP:PFM:REP 636->679|PF12280|8e-04|31.8|44/207|BSMAP| HM:PFM:NREP 5 HM:PFM:REP 137->320|PF00264|4.6e-36|29.5|183/228|Tyrosinase| HM:PFM:REP 457->492|PF01549|2.3e-09|41.7|36/38|ShK| HM:PFM:REP 502->536|PF01549|2.7e-11|40.0|35/38|ShK| HM:PFM:REP 567->602|PF01549|6.2e-08|38.9|36/38|ShK| HM:PFM:REP 611->645|PF01549|2.6e-11|40.0|35/38|ShK| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00264|IPR002227| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00264|IPR002227| RP:SCP:NREP 1 RP:SCP:REP 109->380|1js8A1|6e-31|21.0|238/281|a.86.1.1| HM:SCP:REP 59->382|1bt3A_|3.7e-61|30.7|306/341|a.86.1.2|1/1|Di-copper centre-containing domain| OP:NHOMO 195 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- -------1-----------------------------------1-----------------------213------------1--------------------------------------------------------------------------------------2------------------------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-1---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------1-----971-1-------11-112111----------1111---1-1-11211---------------------------------1---------------Q-K-2111--1---1-11-1-141-11-111-1--1-1-----------1--451653-----88F--2------2--------15----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 549 STR:RPRED 73.1 SQ:SECSTR ######################################################################################################EccGGcEEccGGGccHHHHHHHHHHHHHHHTccTTcTTcHHHccTTccccccccTTHHHHHHHHHHHHHHHHHHHccccccccccTTcGGGccccGGGGcTTcTTccccccTTccTTccccTTcccccccccHHHHHHHHHHHHHHHHTGGGccHHHHHcccccTTccccccccHHHTTHHHHHHHHcTTTTcTTTGGGcHHHHHHHHHHHHHHHHHHTcccccccHHHHTcEEEccccTEEcTTccEETTGGEEEGGGGccTGGGTEEEcccccT#EcTTccEEccHHHHcTTcccccccccccccTTTTT###cccGGGcETTccEEccHHHHcTTccccccTTcccccTTTTEEEccccccccEEEEEEEEccccccccccEEEEEEETTEEEEEEEEEEccccccccccccTTcHHHHccccccccccccccccccTTTHHHHcTTccEEEEEEEEEccccccccEEEEEEEEEEEccTTcccTTccEEEEccTTcTcccccccccEEEEccccccccccccccccccccccccccccccccccccHHH################################################################################################ DISOP:02AL 44-48, 672-673, 677-680| PSIPRED cHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHHccHHHHHHHHccccccccccccccccEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEEcccccccccccccccccccccEEEEEEEEcccccccccccccccccccccEEEccHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHccccccccccccccccccEEEEccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccEEEcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccEEEccccccccc //