[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : C53D5.4
DDBJ      :             S. muris microneme antigen
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
g.37.1
:301 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   230->280 1meyF PDBj 3e-10 43.1 %
:RPS:PDB   230->279 2ctdA PDBj 2e-10 12.0 %
:RPS:SCOP  229->273 2eppA1  g.37.1.1 * 2e-10 22.2 %
:HMM:SCOP  229->279 2cshA1 g.37.1.1 * 4.8e-11 43.1 %
:HMM:PFM   231->253 PF00096 * zf-C2H2 2.3e-06 47.8 23/23  
:HMM:PFM   259->280 PF00096 * zf-C2H2 2e-06 40.9 22/23  
:HMM:PFM   20->110 PF04740 * Transposase_30 0.00083 21.3 89/204  
:BLT:SWISS 12->90 PDK4_SPETR 1e-04 35.1 %
:BLT:SWISS 230->279 ZN792_HUMAN 2e-11 44.0 %
:PROS 233->253|PS00028|ZINC_FINGER_C2H2_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAF39786.2 GT:GENE C53D5.4 GT:PRODUCT S. muris microneme antigen GT:ORG cele0 GT:DATABASE WS208 WP:CE CE28215 WP:PRODUCT S. muris microneme antigen WP:LOCUS WBGene00016905 GB:PROTEIN_ID AAF39786.2 LENGTH 301 SQ:AASEQ MGEFIGNEEFQNFMKATGFIQEFTRRLLERSSKNIIKIPDNLSNVNQLTCLVKQFLREQQDLAVKVEKVQENQKNLSDFVKEKLTNCNCHVQLDVRNLLAKEMKLQDLRQDDGLDFSIKLPSTSSTDFTVSLNQVVDADAQQRFDLELLKMFGAGNIPHFQPPPDLYQHHHIPHTSQQVAQENLAMLANVPKLDDNNAYFDTFSPEKSGKRAKKRAAPSSAHEAQPNNGPYKCRDCEKTFRQKHGLNQHLLTHETNGAFECDGCGKRYSRQESVYRHQRSTPCTKYQNLTTVEHDDTGALF BL:SWS:NREP 2 BL:SWS:REP 12->90|PDK4_SPETR|1e-04|35.1|77/412| BL:SWS:REP 230->279|ZN792_HUMAN|2e-11|44.0|50/632| PROS 233->253|PS00028|ZINC_FINGER_C2H2_1|PDOC00028| SEG 207->221|ksgkrakkraapssa| BL:PDB:NREP 1 BL:PDB:REP 230->280|1meyF|3e-10|43.1|51/84| RP:PDB:NREP 1 RP:PDB:REP 230->279|2ctdA|2e-10|12.0|50/96| HM:PFM:NREP 3 HM:PFM:REP 231->253|PF00096|2.3e-06|47.8|23/23|zf-C2H2| HM:PFM:REP 259->280|PF00096|2e-06|40.9|22/23|zf-C2H2| HM:PFM:REP 20->110|PF04740|0.00083|21.3|89/204|Transposase_30| RP:SCP:NREP 1 RP:SCP:REP 229->273|2eppA1|2e-10|22.2|45/53|g.37.1.1| HM:SCP:REP 229->279|2cshA1|4.8e-11|43.1|51/0|g.37.1.1|1/1|C2H2 and C2HC zinc fingers| OP:NHOMO 137 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------22-211--113427I3-5493211-4222222-251-a2--11-------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 25.9 SQ:SECSTR #############################################################################################################################################################################################################################cHHHHGGGccccccccccccTTcHHHHHHHHHHHTccEEcTTTcccEEccHHHHHHHHTTcccccccccGGGTccccc## DISOP:02AL 69-79, 105-145| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccHHEEcccccHHHHHHHHcccccEEEEHHHcccHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccEEEEEEEEccccccccccEEcccEEccccccccccccccEEEEEcccccccEEEccccccccccccEEEcccccccccccccccccccccEEEEEEEcccccEEEcccccEEccccccEEEEEEEcccccEEEcccccEEcccccEEEEEEEEcccccccccccccccccccc //