[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : D2023.7
DDBJ      :             Yeast ABC1 protein like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:336 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->57 PF01484 * Col_cuticle_N 4e-06 35.4 %
:HMM:PFM   111->138 PF01391 * Collagen 2.2e-05 42.9 28/60  
:HMM:PFM   156->214 PF01391 * Collagen 9.2e-13 44.1 59/60  
:HMM:PFM   224->281 PF01391 * Collagen 1.1e-11 48.3 58/60  
:HMM:PFM   9->57 PF01484 * Col_cuticle_N 3.7e-18 36.7 49/53  
:BLT:SWISS 1->103 ROL6_CAEEL 3e-22 51.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB02874.1 GT:GENE D2023.7 GT:PRODUCT Yeast ABC1 protein like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE09077 WP:PRODUCT Yeast ABC1 protein like WP:LOCUS WBGene00000731 GB:PROTEIN_ID CAB02874.1 LENGTH 336 SQ:AASEQ MSVTKATAGALCLSSATLILSLYAIFSIYSDVQSIWSQLDQEMDQFKVTTDDLWTQMLGLGAATVSNRQRRQGKEQYGGYEAQGVNPGPTCSCSSGNGNGDDALGTGGCPAGPSGPQGSAGPDGIPGIDGQDGFPGENAEDSQNAPFNGCITCAPGKPGSPGERGKPGLRGMRGPRGTGGSPGTDGYPGRPGEMGPPGPPGDDGKPGSNGEKGQDVEQPTPRKGPRGPPGDSGPPGPEGDAGNDGPVGAAGAPGPDGINGFQGPGGPPGEEGKPGEDGKVGDDAAYCPCPDRNAPKENYASAPSHNPSNAPGASYSAGTGGYSGGTGHAQNSYGKK BL:SWS:NREP 1 BL:SWS:REP 1->103|ROL6_CAEEL|3e-22|51.0|100/348| TM:NTM 1 TM:REGION 6->28| SEG 107->136|ggcpagpsgpqgsagpdgipgidgqdgfpg| SEG 164->210|rgkpglrgmrgprgtggspgtdgypgrpgemgppgppgddgkpgsng| SEG 219->283|ptprkgprgppgdsgppgpegdagndgpvgaagapgpdgingfqgpggppgeegkpgedgkvgdd| SEG 312->327|gasysagtggysggtg| RP:PFM:NREP 1 RP:PFM:REP 10->57|PF01484|4e-06|35.4|48/53|Col_cuticle_N| HM:PFM:NREP 4 HM:PFM:REP 111->138|PF01391|2.2e-05|42.9|28/60|Collagen| HM:PFM:REP 156->214|PF01391|9.2e-13|44.1|59/60|Collagen| HM:PFM:REP 224->281|PF01391|1.1e-11|48.3|58/60|Collagen| HM:PFM:REP 9->57|PF01484|3.7e-18|36.7|49/53|Col_cuticle_N| GO:PFM:NREP 1 GO:PFM GO:0042302|"GO:structural constituent of cuticle"|PF01484|IPR002486| OP:NHOMO 6 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------33-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 58-336| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //