[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F09E5.2
DDBJ      :             AHPC\/TSA protein
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  142/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:400 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   214->363 2f9fA PDBj 3e-14 39.1 %
:RPS:PDB   3->400 3c48A PDBj 2e-38 20.3 %
:RPS:SCOP  13->400 1gz5A  c.87.1.6 * 3e-42 8.6 %
:HMM:SCOP  1->400 2bisA1 c.87.1.8 * 3.3e-62 24.1 %
:RPS:PFM   209->373 PF00534 * Glycos_transf_1 4e-15 39.3 %
:HMM:PFM   201->378 PF00534 * Glycos_transf_1 7.9e-46 37.0 165/172  
:HMM:PFM   62->111 PF06189 * 5-nucleotidase 0.00083 24.0 50/264  
:BLT:SWISS 4->396 ALG2_MOUSE 4e-97 46.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAN63415.1 GT:GENE F09E5.2 GT:PRODUCT AHPC\/TSA protein GT:ORG cele0 GT:DATABASE WS208 WP:CE CE32364 WP:PRODUCT AHPC\/TSA protein WP:LOCUS WBGene00017282 GB:PROTEIN_ID AAN63415.1 LENGTH 400 SQ:AASEQ MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKGHALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRNIIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKYVFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPADQIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQTAEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL BL:SWS:NREP 1 BL:SWS:REP 4->396|ALG2_MOUSE|4e-97|46.8|391/415| BL:PDB:NREP 1 BL:PDB:REP 214->363|2f9fA|3e-14|39.1|128/163| RP:PDB:NREP 1 RP:PDB:REP 3->400|3c48A|2e-38|20.3|379/399| RP:PFM:NREP 1 RP:PFM:REP 209->373|PF00534|4e-15|39.3|150/165|Glycos_transf_1| HM:PFM:NREP 2 HM:PFM:REP 201->378|PF00534|7.9e-46|37.0|165/172|Glycos_transf_1| HM:PFM:REP 62->111|PF06189|0.00083|24.0|50/264|5-nucleotidase| GO:PFM:NREP 1 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00534|IPR001296| RP:SCP:NREP 1 RP:SCP:REP 13->400|1gz5A|3e-42|8.6|384/456|c.87.1.6| HM:SCP:REP 1->400|2bisA1|3.3e-62|24.1|386/0|c.87.1.8|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 556 OP:NHOMOORG 353 OP:PATTERN ----111-1111-112-11----1---1------2-----------311-22---11-2-1------- --1----------1---11-1----111111--111-------------------------1------11-1---111-----1-11111-1---------1---11--1---------------------1--11-111111-2---2--11--22------2-1111----11-----11--2---22---------1--1---1-------1----1-----------131-----------------1-----------------------------------------------------------------------1--1-----------1111------1------1----5-21-321221--111------------------------------------1--1------1--111-111-1-----------------------------------------------------------------------------11111----111111--------------1----------1----------------1----1--11----11-1-1------1------31--------------------2--1111---1----1------------------------1--1-----------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------11--22--------------------------------------12--1-111---- --32212-212-11311222233322322222222222222222221122231412122221111111-11111111-1111111111-24212221112121324-11243211132111-22421213C2-336211-312222211122-41222112321221211153311111F1111111352211112221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 400 STR:RPRED 100.0 SQ:SECSTR HHEEEEEcTTcccccHHHHHHHHHHHHHHTTcEEEEEEEcccGGGccEEEEETTEEEEEEcccccccGGGGGGGHHHHHHHHHHHHHHHTccccEEEEEHHHHHHHHHHHHHHHTccEEEEccccTcHHHHcccccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHcccGGGGEEEccccccTTTcccccHHHHHHTTcccccEEEEEEEccccGGGcHHHHHHHHHHHHHHcTTccccTccEEEEEEccccHHHHHHcccHHHHHHHHTTcTTTTEEEEccccHHHHHHHHHHccEEEEccccccccHHHHHHHHTTccEEEEccTTHHHHcccTTTEEEEcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHH DISOP:02AL 400-401| PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHccccEEEEEccccHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHccccHHHEEEEcccccHHHccccccHHHHHHcccccccEEEEEEEEccHHccHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccEEEEccccccccHHHHHHHHccccEEEccccccHHHHcccccEEEEcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHc //