[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F20H11.6
DDBJ      :             D-amino acid oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:393 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAD34659.1 GT:GENE F20H11.6 GT:PRODUCT D-amino acid oxidase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE20703 WP:PRODUCT D-amino acid oxidase WP:LOCUS WBGene00017649 GB:PROTEIN_ID AAD34659.1 LENGTH 393 SQ:AASEQ MDDILSAALAESGLDFLCQQSSPTPSTSGSIHDDAGQSFSNNTHTPSVSQFFDETSNDSHSSSAYYTPMATPFVSTEDGGVPTSFFGMDEEDGGCTIMTTAGTSGSNNIDGIEDAGGGMYYPHVKVIPRKHTAPTVNQSEPSTPTVTIVPKKEDPLFETNTADSPTPSGDTSTTASYEGNDGLEDQETTSDRQNPMFVQTARSTDFATKKNQMAEQAHFLRFSVFWQKSGRLDTPSTSATVSPHITSSLTQRSHTSSPASSASEGTVVPPRKKGLPITTGSIVKRTVQTKDGLQTQYLKAFVNENGEKIYKLLSPVAASAVARGTLPPGMGRGGSTIGRGGTMVNKNGERLMVVKNHVGPNGQMLVKRMVSPAGTRIVANGGQGRGQPIYRGT SEG 19->28|qqssptpsts| SEG 161->176|tadsptpsgdtsttas| SEG 253->263|shtsspassas| SEG 329->343|gmgrggstigrggtm| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 22-34, 166-173, 180-190, 250-268, 387-393| PSIPRED cHHHHHHHHHHcccHHEEccccccccccccccccccccccccccccHHHHHHHHcccccccccEEEccccccEEccccccccccccccccccccEEEEEEccccccccccccccccccEEccEEEEEEccccccccccccccccEEEEEEccccccEEcccccccccccccccEEccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHEEEEEEEEccccccccccccEEccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccEEEEEEccccccHHHHHHHHHcccccEEEEcccccccccccccc //