[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F22B5.2
DDBJ      :             tyrosine-protein kinase
Swiss-Prot:EIF3G_CAEEL  RecName: Full=Eukaryotic translation initiation factor 3 subunit G;         Short=eIF3g;AltName: Full=Eukaryotic translation initiation factor 3 subunit 4;AltName: Full=Eukaryotic translation initiation factor 3 RNA-binding subunit;         Short=eIF-3 RNA-binding subunit;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
d.58.7
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   169->255 2cq0A PDBj 8e-21 47.1 %
:RPS:PDB   180->254 1cvjF PDBj 1e-16 26.7 %
:RPS:SCOP  180->253 1cvjA1  d.58.7.1 * 2e-19 27.0 %
:HMM:SCOP  159->257 1u6fA1 d.58.7.1 * 8.3e-27 37.4 %
:RPS:PFM   27->137 PF12353 * eIF3g 1e-15 43.1 %
:RPS:PFM   180->238 PF00076 * RRM_1 2e-14 54.2 %
:HMM:PFM   19->140 PF12353 * eIF3g 1.1e-36 40.0 120/126  
:HMM:PFM   180->245 PF00076 * RRM_1 8e-24 46.2 65/70  
:BLT:SWISS 1->256 EIF3G_CAEEL e-143 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA90354.1 GT:GENE F22B5.2 GT:PRODUCT tyrosine-protein kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE02197 WP:PRODUCT tyrosine-protein kinase WP:LOCUS WBGene00001230 GB:PROTEIN_ID CAA90354.1 LENGTH 256 SQ:AASEQ MAPAPEVVSWAEAVEQDNAPHIQEGADGTRTETAFTEVDGVRWKVVTQFKVINKRVPKVVADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREHCRHCKGNDHWSTHCPYKVMYQLDEEADADKDTEKDRMAMGMRPDGRQIDRNRSDENTCRVTNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDIRMYHMVLKVEWTRPSN SW:ID EIF3G_CAEEL SW:DE RecName: Full=Eukaryotic translation initiation factor 3 subunit G; Short=eIF3g;AltName: Full=Eukaryotic translation initiation factor 3 subunit 4;AltName: Full=Eukaryotic translation initiation factor 3 RNA-binding subunit; Short=eIF-3 RNA-binding subunit; SW:GN Name=eif-3.G; ORFNames=F22B5.2; SW:KW Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis;RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|EIF3G_CAEEL|e-143|100.0|256/256| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003743|"GO:translation initiation factor activity"|Initiation factor| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| SEG 143->155|deeadadkdtekd| BL:PDB:NREP 1 BL:PDB:REP 169->255|2cq0A|8e-21|47.1|87/103| RP:PDB:NREP 1 RP:PDB:REP 180->254|1cvjF|1e-16|26.7|75/131| RP:PFM:NREP 2 RP:PFM:REP 27->137|PF12353|1e-15|43.1|109/126|eIF3g| RP:PFM:REP 180->238|PF00076|2e-14|54.2|59/71|RRM_1| HM:PFM:NREP 2 HM:PFM:REP 19->140|PF12353|1.1e-36|40.0|120/126|eIF3g| HM:PFM:REP 180->245|PF00076|8e-24|46.2|65/70|RRM_1| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00076|IPR000504| RP:SCP:NREP 1 RP:SCP:REP 180->253|1cvjA1|2e-19|27.0|74/80|d.58.7.1| HM:SCP:REP 159->257|1u6fA1|8.3e-27|37.4|99/0|d.58.7.1|1/1|RNA-binding domain, RBD| OP:NHOMO 657 OP:NHOMOORG 188 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11112-1-2---11122111222111111111111112112121111212111112411112111111111--11111111111111--12121111111121112-24-3C866A33534556XA2C4RrA-G9J4563B467645543843A3644332B63333M36722321111H1112133441341211112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 53.5 SQ:SECSTR #######################################################################################################################EccccHHHHHHHHHHHHHHHHHHHcccccGGGTTcccccccccccccccccccTTccEEEEEcccTTccHHHHHHHHGGGccEEEEEEEEcTTTccEEEEEEEEEccHHHHHHHHTTccccEETTEEcEEEEccccc DISOP:02AL 1-4, 76-78, 96-117, 138-177, 255-256| PSIPRED cccccccccccccccccccccEEEcccccEEEEEEEEcccEEEEEEEEEEEEEEEccHHHHHccccccccccccccccccccEEEEEcEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEcccccEEccccHHHHHcccccHHHHHccccHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEccHHHHHHHHHHHccEEEccEEEEEEEccccc //