[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F22D6.12
DDBJ      :             tyrosine-protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
:436 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   57->399 2gamD PDBj 5e-32 30.0 %
:RPS:PFM   116->318 PF02485 * Branch 3e-22 34.5 %
:HMM:PFM   116->370 PF02485 * Branch 5.2e-66 36.5 230/242  
:HMM:PFM   8->49 PF10320 * 7TM_GPCR_Srsx 0.00044 28.6 42/257  
:BLT:SWISS 59->392 GCNT3_RAT 4e-33 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA95816.4 GT:GENE F22D6.12 GT:PRODUCT tyrosine-protein kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE29590 WP:PRODUCT tyrosine-protein kinase WP:LOCUS WBGene00001644 GB:PROTEIN_ID CAA95816.4 LENGTH 436 SQ:AASEQ MVRFKFKTSLIIAIFFLFIYFSVESLFPRKQEDKNVSKQFLKSICTTASDSYLLDNMEINCSNILKGYKTNEKLDIMHLDIIEEQLFSCTNKCQTLKTLFRFNTNPMSAEEKHFPLSYGMLVYKDLPQVLFLLSSIYHPQNEYCIAVGENSAPIFQNLLREVSTCFSNVHFMKRPPISWGSHEIIDSVYDCLEFLSHLETDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTSNVEITNYQQARLTGKNENESPLPLFKSSLSAIIPRKAANQLASSNTARKLLEFLWNTEIADEGFWGTLFGNKDQFNISGSINSKDWMEYRDNQNNIFNPTDGWSYYISRDQIWDPELCKNYMKDDSCVFGIGDVPRLRTSKALVAHKFYLKSEPEAYFCLLKEHHRRTINPDLTFDASKYSELPQVELSRGLAMSQLTHQNWIL BL:SWS:NREP 1 BL:SWS:REP 59->392|GCNT3_RAT|4e-33|30.8|321/437| TM:NTM 1 TM:REGION 7->28| SEG 10->21|liiaifflfiyf| BL:PDB:NREP 1 BL:PDB:REP 57->399|2gamD|5e-32|30.0|333/368| RP:PFM:NREP 1 RP:PFM:REP 116->318|PF02485|3e-22|34.5|203/243|Branch| HM:PFM:NREP 2 HM:PFM:REP 116->370|PF02485|5.2e-66|36.5|230/242|Branch| HM:PFM:REP 8->49|PF10320|0.00044|28.6|42/257|7TM_GPCR_Srsx| GO:PFM:NREP 2 GO:PFM GO:0008375|"GO:acetylglucosaminyltransferase activity"|PF02485|IPR003406| GO:PFM GO:0016020|"GO:membrane"|PF02485|IPR003406| OP:NHOMO 353 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2574466434445387293ESC-7584554835B6534316347253561216KK------AE23------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 76.6 SQ:SECSTR ########################################################ccccHHHHTTT#ccHHHHHHHHHHHcccHHHHHHHcHHHHHHHHTccccccccTTTTccEEEEEEEcccHHHHHHHHHHHccTTcEEEEEEcTTccHHHHHHHHHHHHTcTTEEEcccccccTTcHHHHHHHHHHHHHHHHHcccccEEEEEETTEEEcccHHHHHHHHHHTTTccccccEEcEEEEETTEEEEEEccccEEcccccEEEHHHHHHHHHcHHHHHHHHHHTTcccGGGTHHHHHTTcTT###cTTcccccG##GGcccTTTcccEEcccTTTGGGTccccc##cccEEETTEEEcccTHHHHHTTccccEEEcccTTTccHHHHH#HHHHHHH##################################### PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHcccccccccccccccccHHHHHcccccccHHccccccccccccccccccHHHHHHHHcccccccccHHHcccEEEEEHHHccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEEccccEEEEEHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHccccccccccccccccccEEccccccccccccccccccEEEEcHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccccccHHHHHccccEEEEccccccccccccccc //