[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F26A1.12
DDBJ      :             Yeast hypothetical 65.2 KD protein like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.169.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   101->179 1egiB PDBj 6e-04 37.9 %
:RPS:PDB   73->231 1egiB PDBj 7e-09 22.4 %
:RPS:SCOP  87->230 1byfA  d.169.1.1 * 4e-07 18.3 %
:HMM:SCOP  73->231 1ukmB_ d.169.1.1 * 9.5e-19 28.7 %
:HMM:PFM   101->193 PF00059 * Lectin_C 1.3e-06 22.8 79/108  
:BLT:SWISS 73->179 CLC4M_HYLLA 9e-04 28.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAA68253.1 GT:GENE F26A1.12 GT:PRODUCT Yeast hypothetical 65.2 KD protein like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE02680 WP:PRODUCT Yeast hypothetical 65.2 KD protein like WP:LOCUS WBGene00017810 GB:PROTEIN_ID AAA68253.1 LENGTH 231 SQ:AASEQ MRSMKVFISIGVVLSVVNCIFFDHGDSSDGSYSDSSGEGRGHHHKHGPRPPRPNRPPRPPPATPPPTTPAPSCPGGWSLIHRRRGPWCIQVFNGAAGLEGSNNACRAQGAVLSSVENAQERETIARLGLEKMLPTGWKYGTIRVGLRKNSQGAPWYNTDGSTDANNLEGVLWSPAEPRNGNWGGVQLNCATMWLWGGIFEGGRIHGQFFTNICLANNPNDRYRGYVCGKPA BL:SWS:NREP 1 BL:SWS:REP 73->179|CLC4M_HYLLA|9e-04|28.4|95/399| SEG 23->39|dhgdssdgsysdssgeg| SEG 48->71|prpprpnrpprpppatpppttpap| BL:PDB:NREP 1 BL:PDB:REP 101->179|1egiB|6e-04|37.9|66/143| RP:PDB:NREP 1 RP:PDB:REP 73->231|1egiB|7e-09|22.4|134/143| HM:PFM:NREP 1 HM:PFM:REP 101->193|PF00059|1.3e-06|22.8|79/108|Lectin_C| RP:SCP:NREP 1 RP:SCP:REP 87->230|1byfA|4e-07|18.3|120/123|d.169.1.1| HM:SCP:REP 73->231|1ukmB_|9.5e-19|28.7|122/124|d.169.1.1|1/1|C-type lectin-like| OP:NHOMO 20 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------6E-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 67.5 SQ:SECSTR #######################################################################cccTTcEEcTTcEEEEEcccGGGcccHHHHHHHHHHTTcEEcccccHHHHHHHHHHHHTTTcTTcEEETcTTEEEEccccTTccccTTccccccccccccccTTcccGGGcccGccEEEEEETTTTEE##ccTTccEEEEET##EEcTTcccEEEEEEET DISOP:02AL 1-2, 25-67| PSIPRED ccHHHHHHHHHHHHHHHHHHEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccEEEEEcccccccccccEEccccccccccccccccEEEEEEcccccccccccccccccccccccccccEEEEEEcccc //