[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F27C1.8
DDBJ      :             phosphoserine aminotransferase
Swiss-Prot:DPY5_CAEEL   RecName: Full=Cuticle collagen dpy-5;AltName: Full=Protein dumpy-5;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   140->208 1af0A PDBj 4e-04 23.5 %
:HMM:PFM   95->124 PF01391 * Collagen 1.1e-07 50.0 30/60  
:HMM:PFM   141->198 PF01391 * Collagen 4.4e-13 44.8 58/60  
:HMM:PFM   211->263 PF01391 * Collagen 0.0002 49.1 53/60  
:HMM:PFM   8->55 PF01484 * Col_cuticle_N 1.8e-17 29.2 48/53  
:BLT:SWISS 1->284 DPY5_CAEEL e-104 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAB37656.1 GT:GENE F27C1.8 GT:PRODUCT phosphoserine aminotransferase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE09720 WP:PRODUCT phosphoserine aminotransferase WP:LOCUS WBGene00001067 GB:PROTEIN_ID AAB37656.1 LENGTH 284 SQ:AASEQ MVKAVVGFGAACGISAIVACLWAALVITNDINDMYDDVMGELGGFRDISDDTWGTLLDVRHGAGESAEQYVRGIFGRHKRSNSQCSCGLPSQGCPAGAPGNPGAPGEPGGTGPDGKNGPTGLPGLNIPIPNDFPKECIKCPAGPPGQDGLPGQEGFQGLPGDAGKRGTPGKDGEPGRVGDIGDQGTPGQDGQPGLAGPPGRDGLTGKGQPGVAGRPGMPGPRGEPGNNGNPGEEGQTGAQGPTGQPGKDGFNGNDGTPGQAGPQGAVGADAEYCPCPERKRRRV SW:ID DPY5_CAEEL SW:DE RecName: Full=Cuticle collagen dpy-5;AltName: Full=Protein dumpy-5; SW:GN Name=dpy-5; ORFNames=F27C1.8; SW:KW Collagen; Complete proteome; Cuticle; Disulfide bond; Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->284|DPY5_CAEEL|e-104|100.0|284/284| GO:SWS:NREP 1 GO:SWS GO:0042302|"GO:structural constituent of cuticle"|Cuticle| TM:NTM 1 TM:REGION 6->28| SEG 93->121|gcpagapgnpgapgepggtgpdgkngptg| SEG 179->194|gdigdqgtpgqdgqpg| SEG 214->247|grpgmpgprgepgnngnpgeegqtgaqgptgqpg| SEG 255->271|dgtpgqagpqgavgada| RP:PDB:NREP 1 RP:PDB:REP 140->208|1af0A|4e-04|23.5|51/470| HM:PFM:NREP 4 HM:PFM:REP 95->124|PF01391|1.1e-07|50.0|30/60|Collagen| HM:PFM:REP 141->198|PF01391|4.4e-13|44.8|58/60|Collagen| HM:PFM:REP 211->263|PF01391|0.0002|49.1|53/60|Collagen| HM:PFM:REP 8->55|PF01484|1.8e-17|29.2|48/53|Col_cuticle_N| OP:NHOMO 9 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------12----------33-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 19.0 SQ:SECSTR ########################################################################################################################################HHHccTTccccEEEcTTccccEEEccccccEEEccccccE##################EEccccccEEEccc############################################################################ DISOP:02AL 38-284| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //