[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F32B6.6
DDBJ      :             Human HPRP18 protein like
Swiss-Prot:MSP77_CAEEL  RecName: Full=Major sperm protein 77/79;         Short=MSP;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.1.11
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->127 1grwA PDBj 5e-73 99.2 %
:RPS:PDB   4->126 2bvuD PDBj 1e-30 81.3 %
:RPS:SCOP  4->127 1grwA  b.1.11.2 * 4e-28 99.2 %
:HMM:SCOP  4->127 1mspA_ b.1.11.2 * 1.2e-42 34.7 %
:RPS:PFM   10->101 PF00635 * Motile_Sperm 2e-10 32.6 %
:HMM:PFM   10->113 PF00635 * Motile_Sperm 3.3e-29 26.9 104/109  
:BLT:SWISS 1->127 MSP77_CAEEL 1e-74 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB03037.1 GT:GENE F32B6.6 GT:PRODUCT Human HPRP18 protein like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE09861 WP:PRODUCT Human HPRP18 protein like WP:LOCUS WBGene00003464 GB:PROTEIN_ID CAB03037.1 LENGTH 127 SQ:AASEQ MAQSVPPGDIQTQPGTKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMARRKNLPIEYNP SW:ID MSP77_CAEEL SW:DE RecName: Full=Major sperm protein 77/79; Short=MSP; SW:GN Name=msp-77; ORFNames=F32B6.6;andName=msp-79; ORFNames=T13F2.10; SW:KW Acetylation; Cell projection; Complete proteome; Cytoplasm;Cytoskeleton. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->127|MSP77_CAEEL|1e-74|100.0|127/127| GO:SWS:NREP 3 GO:SWS GO:0042995|"GO:cell projection"|Cell projection| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005856|"GO:cytoskeleton"|Cytoskeleton| BL:PDB:NREP 1 BL:PDB:REP 4->127|1grwA|5e-73|99.2|124/124| RP:PDB:NREP 1 RP:PDB:REP 4->126|2bvuD|1e-30|81.3|123/124| RP:PFM:NREP 1 RP:PFM:REP 10->101|PF00635|2e-10|32.6|92/104|Motile_Sperm| HM:PFM:NREP 1 HM:PFM:REP 10->113|PF00635|3.3e-29|26.9|104/109|Motile_Sperm| GO:PFM:NREP 1 GO:PFM GO:0005198|"GO:structural molecule activity"|PF00635|IPR000535| RP:SCP:NREP 1 RP:SCP:REP 4->127|1grwA|4e-28|99.2|124/124|b.1.11.2| HM:SCP:REP 4->127|1mspA_|1.2e-42|34.7|124/0|b.1.11.2|1/1|PapD-like| OP:NHOMO 66 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------Nh-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 100.0 SQ:SECSTR cccccccccEEEEccccEEEEccccccEEEEEEEEEcccccEEEEEEEccTTTEEccccEEEEcTTcEEEEEEEEccccTTTccccccEEEEEEEEccTTccccccTHHHHcccccEEEEEEEEEEc DISOP:02AL 1-3| PSIPRED ccccccccEEEEccccEEEEcccccccEEEEEEEEcccccEEEEEEEEccccEEEEccccccccccccEEEEEEEcccccccccccccEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEEEEcc //