[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F33A8.2
DDBJ      :             transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 37->92 ALLP_HELAM 7e-05 44.4 %
:TM
:REPEAT 3|40->50|71->81|83->92

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB04255.2 GT:GENE F33A8.2 GT:PRODUCT transport protein GT:ORG cele0 GT:DATABASE WS208 WP:CE CE32885 WP:PRODUCT transport protein WP:LOCUS WBGene00003756 GB:PROTEIN_ID CAB04255.2 LENGTH 99 SQ:AASEQ MNANVYSIVYFLSFLVLCISAQLHADSGATEVDGIVDKRSPYRAFAFAKRSDEENLDFLEKRARYGFAKRSPYRTFAFAKRASPYGFAFAKRGQFSSFA BL:SWS:NREP 1 BL:SWS:REP 37->92|ALLP_HELAM|7e-05|44.4|54/225| TM:NTM 1 TM:REGION 1->22| NREPEAT 1 REPEAT 3|40->50|71->81|83->92| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 97-99| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHcccccccEEccccccccc //