[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F36H12.8
DDBJ      :             protein-tyrosine phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->300 1ckjB PDBj 4e-26 30.4 %
:RPS:PDB   26->302 2c47A PDBj 3e-16 22.7 %
:RPS:SCOP  18->279 1nw1A  d.144.1.8 * 2e-12 7.7 %
:HMM:SCOP  18->303 1csnA_ d.144.1.7 * 2.1e-53 30.6 %
:RPS:PFM   22->168 PF00069 * Pkinase 1e-10 39.6 %
:HMM:PFM   21->263 PF00069 * Pkinase 7.5e-23 26.4 227/260  
:BLT:SWISS 18->301 TTBK2_HUMAN 9e-60 44.3 %
:PROS 136->148|PS00108|PROTEIN_KINASE_ST
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAC26932.1 GT:GENE F36H12.8 GT:PRODUCT protein-tyrosine phosphatase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE09979 WP:PRODUCT protein-tyrosine phosphatase WP:LOCUS WBGene00018122 GB:PROTEIN_ID AAC26932.1 LENGTH 311 SQ:AASEQ MTAPPPPLVELPPGSMVERWSITKKLGEGGCGAVYLCTDATGKYALKVEGISEAMQVLKMEVLVLGELTKRGSRHFCKIEDKGRYGSFNYVVMTLVGKSLQDLRKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIGRAELNELRKVYILDFGMARKFTDNNGVIRKPRAAAGFRGTVRYAPIACHKNQELGRKDDVEVWLYMQVELTVGRVPWKEITDMNAVGQAKQAIRNTPEKMFVFPCPANELKEIMKMVDSWDYFADPNYADCYRLMKQTLANCGKPEYPYDWEPGMPLNYMVK BL:SWS:NREP 1 BL:SWS:REP 18->301|TTBK2_HUMAN|9e-60|44.3|271/1244| PROS 136->148|PS00108|PROTEIN_KINASE_ST|PDOC00100| SEG 4->13|pppplvelpp| BL:PDB:NREP 1 BL:PDB:REP 19->300|1ckjB|4e-26|30.4|276/293| RP:PDB:NREP 1 RP:PDB:REP 26->302|2c47A|3e-16|22.7|273/288| RP:PFM:NREP 1 RP:PFM:REP 22->168|PF00069|1e-10|39.6|139/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 21->263|PF00069|7.5e-23|26.4|227/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 18->279|1nw1A|2e-12|7.7|247/365|d.144.1.8| HM:SCP:REP 18->303|1csnA_|2.1e-53|30.6|281/0|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 1588 OP:NHOMOORG 248 OP:PATTERN -------------------------------------------------------------------- 124----1---1-1-------1-----------111---1------1-1---111---------1----1--111-------------------------------------------------------------1111----3---------1-----------2121-------------------1-------------------------------------------------------------------------------------1-----------------------------------------------1---1-----------1111111-------11------1-------1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--3-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------- 3122314-F6613322221222233322222222222422323222124322323522322323433323453334434433443255-59624C94322262BBF25267ELBDJF88869B9UU4L5i*H1LCS68A4M58K969878C75O9DBAA6DAI9553O56H**671442L33345BEOJ2K54223334 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 95.8 SQ:SECSTR #############cHHcEEEEEEEcEEEEEEccEEEEEETTccEEEEEEETTcccccHHHHHHHHHHTTTETTcTTcccEEEEEETTEEEEEEEcccccHHHHHHHTETTcccHHHHHHHHHHHHHHHHHHHHTTEEcccccGGGEEEccTTcTTTTcEEcccTTcEEcccTTTcccccccccccccccTTTccHHHHTTccccHHHHHHHHHHHHHHHHHcccTTTTcccccHHHHHHHHHHHTccHHHHTTTccHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHTTccccccTTTTccEEEEEHH DISOP:02AL 1-13, 306-309| PSIPRED cccccccccccccccccccEEEEEEEEcccccEEEEEEEccccEEEEEEEHHHcHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHEEEEccccccccEEEEEEccHHHEEEcccccEEEccccccEEEcHHHccHHHHccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccc //