[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F39B2.11
DDBJ      :             Zinc finger, C2H2 type (7 domains)
Swiss-Prot:MTX1_CAEEL   RecName: Full=Metaxin-1 homolog;AltName: Full=Mitochondrial outer membrane import complex protein 1;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  71/199 : Viruses  0/175   --->[See Alignment]
a.45.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   161->252 3c8eB PDBj 6e-06 13.0 %
:RPS:SCOP  158->240 1jlvA1  a.45.1.1 * 3e-06 22.4 %
:HMM:SCOP  86->251 1b4pA1 a.45.1.1 * 5.9e-11 25.0 %
:RPS:PFM   3->73 PF10568 * Tom37 8e-13 50.0 %
:RPS:PFM   156->210 PF11801 * Tom37_C 1e-05 41.8 %
:HMM:PFM   3->59 PF10568 * Tom37 9e-12 28.1 57/72  
:HMM:PFM   95->147 PF11801 * Tom37_C 6.3e-07 22.6 53/168  
:HMM:PFM   154->228 PF00043 * GST_C 1.8e-06 21.2 66/95  
:BLT:SWISS 1->312 MTX1_CAEEL e-158 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB07391.1 GT:GENE F39B2.11 GT:PRODUCT Zinc finger, C2H2 type (7 domains) GT:ORG cele0 GT:DATABASE WS208 WP:CE CE16016 WP:PRODUCT Zinc finger, C2H2 type (7 domains) WP:LOCUS WBGene00009559 GB:PROTEIN_ID CAB07391.1 LENGTH 312 SQ:AASEQ MELHIWPSDFGLPTIDVVSLQFLACSKMCASPVRVIQSTRPWRSPSGELPMVAQTEGEAKPVTDFEKFVDILKKCGQDVVIDADLTTIEKAQLDAFSCYLHHNLYPAVMHTFWTDELNYNTVTQYWYASHLHFPYNLYYLEKRRKKALRLLAGKNDTEILKEAFMALNTLSTKLGDNKFFCGNKPTSLDALVFGYLAPLLRVPLPNDRLQVQLSACPNLVRFVETVSSIYLPLGEDELKRQQANRKMWQSRISKAKADKEAAKTTEEASESLPEEPPMRDAILFTLGALTLSLVFAIHTGLIQVSVEEEISE SW:ID MTX1_CAEEL SW:DE RecName: Full=Metaxin-1 homolog;AltName: Full=Mitochondrial outer membrane import complex protein 1; SW:GN Name=mtx-1; ORFNames=F39B2.11; SW:KW Complete proteome; Membrane; Mitochondrion;Mitochondrion outer membrane; Protein transport; Transmembrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->312|MTX1_CAEEL|e-158|100.0|312/312| GO:SWS:NREP 6 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0005739|"GO:mitochondrion"|Mitochondrion| GO:SWS GO:0005741|"GO:mitochondrial outer membrane"|Mitochondrion outer membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 142->152|krrkkalrlla| SEG 253->277|skakadkeaaktteeaseslpeepp| RP:PDB:NREP 1 RP:PDB:REP 161->252|3c8eB|6e-06|13.0|92/283| RP:PFM:NREP 2 RP:PFM:REP 3->73|PF10568|8e-13|50.0|68/68|Tom37| RP:PFM:REP 156->210|PF11801|1e-05|41.8|55/164|Tom37_C| HM:PFM:NREP 3 HM:PFM:REP 3->59|PF10568|9e-12|28.1|57/72|Tom37| HM:PFM:REP 95->147|PF11801|6.3e-07|22.6|53/168|Tom37_C| HM:PFM:REP 154->228|PF00043|1.8e-06|21.2|66/95|GST_C| GO:PFM:NREP 2 GO:PFM GO:0005741|"GO:mitochondrial outer membrane"|PF10568|IPR019564| GO:PFM GO:0006626|"GO:protein targeting to mitochondrion"|PF10568|IPR019564| RP:SCP:NREP 1 RP:SCP:REP 158->240|1jlvA1|3e-06|22.4|76/123|a.45.1.1| HM:SCP:REP 86->251|1b4pA1|5.9e-11|25.0|124/133|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 208 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------113----------------------------------1-----------------------------------------------------212----3343253312-24262142AO5-539231142342221134224-33322312211-12332221--------111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 153 STR:RPRED 49.0 SQ:SECSTR #################################################################################################cHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHH##HHcHHHHHHHHHHHHHHHHHHTTcccTTcccccHHHHHHTTTHHHHHHTccTTcHHHHTGGGcHHHHHHHHHHHTcHTTcTcccccGGGcccccccTTH############################################################ DISOP:02AL 245-280, 309-312| PSIPRED cEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHcc //