[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F41E6.9
DDBJ      :             glycolate oxidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   32->173 PF03357 * Snf7 6e-09 33.8 %
:HMM:PFM   12->196 PF03357 * Snf7 4e-54 41.7 168/171  
:BLT:SWISS 1->217 CHMP5_XENTR 3e-54 55.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAB65951.1 GT:GENE F41E6.9 GT:PRODUCT glycolate oxidase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE10260 WP:PRODUCT glycolate oxidase WP:LOCUS WBGene00018290 GB:PROTEIN_ID AAB65951.1 LENGTH 217 SQ:AASEQ MNRIFGTGKKVPPPDLNNAISNVESRSDSIDKKIQKLDQDLMKLRDQMSKMREGPSKNLIKQKALRVLKQKRMYENQKGQLDQQAFNMDQSNFAIQGMKDNQVTVAAMKDGLKTMQKEYKKMNIDQIEDLQDQMEDMLDMNNEIQEAMSRQYDTPDIDEADLEAELAMLGDELDIGESDTNYLDEALAAPTVPSDKPKTRVAEGLEVDEFGLPKLPA BL:SWS:NREP 1 BL:SWS:REP 1->217|CHMP5_XENTR|3e-54|55.1|216/219| SEG 128->143|edlqdqmedmldmnne| RP:PFM:NREP 1 RP:PFM:REP 32->173|PF03357|6e-09|33.8|142/170|Snf7| HM:PFM:NREP 1 HM:PFM:REP 12->196|PF03357|4e-54|41.7|168/171|Snf7| GO:PFM:NREP 1 GO:PFM GO:0015031|"GO:protein transport"|PF03357|IPR005024| OP:NHOMO 231 OP:NHOMOORG 181 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-211-111-111111111111112111111111111111111111111111-11-111111111-11111-1111111111-111111111111-1111-1211222221111111113-31161-111111111111-111111111111111211111112611111111H11111224214111-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-21, 55-56, 178-209| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHccccccccccccccccccccccccHHHcccccccc //