[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F41G3.14
DDBJ      :             cuticlin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.82.1d.14.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   88->277 2nn6C PDBj 8e-11 25.3 %
:RPS:PDB   1->277 2c38A PDBj 9e-24 21.3 %
:RPS:SCOP  1->159 2nn6A1  d.14.1.4 * 5e-13 20.4 %
:RPS:SCOP  148->245 1a4sA  c.82.1.1 * 3e-04 21.6 %
:HMM:SCOP  22->166 1r6lA1 d.14.1.4 * 7e-06 25.9 %
:RPS:PFM   113->159 PF01138 * RNase_PH 6e-07 57.4 %
:RPS:PFM   214->268 PF04636 * PA26 8e-04 32.7 %
:HMM:PFM   47->159 PF01138 * RNase_PH 8.7e-12 26.2 103/132  
:BLT:SWISS 88->277 EXOS8_HUMAN 3e-10 25.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAK93855.1 GT:GENE F41G3.14 GT:PRODUCT cuticlin GT:ORG cele0 GT:DATABASE WS208 WP:CE CE28932 WP:PRODUCT cuticlin WP:LOCUS WBGene00018305 GB:PROTEIN_ID AAK93855.1 LENGTH 277 SQ:AASEQ MSSEVLRGIDPRGYFATFIKEGVYPDGRGLLDEQKLVFKQGECGGVGSSVVSTQGVTVSCSIQASVSLVSDAPLVDIKIEGSQQLSEKDAEDCNSVLLSLFTNNCFVRRENLRCLDVCGKPLPLEWQLHIIVKVLSLEGNFLDAAVCALGAALVDAKLPSIVLNHSEGDESTIEKTQIQADYRTMHRLTLEEPLMCCSFGIFVDVNSDKKSEVLLLSPTLEAISVCRATCSVIVGKDDHMVMVRERGQFSSFSLLKKMCQITAERRHKFVESLQNVV BL:SWS:NREP 1 BL:SWS:REP 88->277|EXOS8_HUMAN|3e-10|25.3|170/276| SEG 40->61|qgecggvgssvvstqgvtvscs| BL:PDB:NREP 1 BL:PDB:REP 88->277|2nn6C|8e-11|25.3|170/270| RP:PDB:NREP 1 RP:PDB:REP 1->277|2c38A|9e-24|21.3|253/271| RP:PFM:NREP 2 RP:PFM:REP 113->159|PF01138|6e-07|57.4|47/130|RNase_PH| RP:PFM:REP 214->268|PF04636|8e-04|32.7|55/414|PA26| HM:PFM:NREP 1 HM:PFM:REP 47->159|PF01138|8.7e-12|26.2|103/132|RNase_PH| GO:PFM:NREP 5 GO:PFM GO:0000175|"GO:3'-5'-exoribonuclease activity"|PF01138|IPR001247| GO:PFM GO:0003723|"GO:RNA binding"|PF01138|IPR001247| GO:PFM GO:0006396|"GO:RNA processing"|PF01138|IPR001247| GO:PFM GO:0005634|"GO:nucleus"|PF04636|IPR006730| GO:PFM GO:0007050|"GO:cell cycle arrest"|PF04636|IPR006730| RP:SCP:NREP 2 RP:SCP:REP 1->159|2nn6A1|5e-13|20.4|152/184|d.14.1.4| RP:SCP:REP 148->245|1a4sA|3e-04|21.6|97/503|c.82.1.1| HM:SCP:REP 22->166|1r6lA1|7e-06|25.9|135/151|d.14.1.4|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------1------------------1--------1--------1------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 99.6 SQ:SECSTR ccccccccHHHHHHHHHHHTTTcccccccTTccccEEEEEcccTTccEEEEEEETTEEEE#EEEEEEEEEEcccTTcTTccEEEEEccccccHHHHHHHHHHHHHHHTTTcccGGGGEEETTTEEEEEEEEEEEEEccccHHHHHHHHHHHHHHTcEEEEEEccEEEEEEEEccTTcEEETTcEEEEcccccccEEEEEEEETTEcEETTTTEEEEcccHHHHHHccEEEEEEEcTTccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-2, 82-95| PSIPRED ccccHHccccHHHHHHHHHHccccccccccccEEcEEEEEcccccccEEEEEEccEEEEEEEEEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHccccccccccccEEEEcccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEcccEEEEEccccccccccccccccccccccEEEEEEEEEcccccccccEEEEEccHHHHHHHccEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHc //