[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F42H10.6
DDBJ      :             Protein phosphatase
Swiss-Prot:YLZ6_CAEEL   RecName: Full=Putative esterase F42H10.6;         EC=3.1.2.-;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:169 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->151 3f5oC PDBj 3e-26 42.4 %
:RPS:PDB   28->153 3b7kA PDBj 3e-15 16.0 %
:RPS:SCOP  28->156 2hboA1  d.38.1.5 * 2e-19 18.3 %
:HMM:SCOP  27->155 1zkiA1 d.38.1.5 * 3.9e-25 32.0 %
:RPS:PFM   69->137 PF03061 * 4HBT 6e-10 46.3 %
:HMM:PFM   69->143 PF03061 * 4HBT 3.8e-19 36.0 75/79  
:HMM:PFM   37->69 PF04164 * DUF400 9e-05 30.3 33/88  
:BLT:SWISS 1->169 YLZ6_CAEEL 9e-94 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAA28024.2 GT:GENE F42H10.6 GT:PRODUCT Protein phosphatase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE24969 WP:PRODUCT Protein phosphatase WP:LOCUS WBGene00018370 GB:PROTEIN_ID AAA28024.2 LENGTH 169 SQ:AASEQ MVGHSESSTDAVIEPTSEELLAEQVRVFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVVQHQHLNSKGTLHGGQTATLTDVITARAVGVTVKDKGMASVELAVSYLLPVKVGDVLEITAHVLKVGRTMAFTDCEFRRKSDGKMSAKGKHTLAFLPNQPGISVENGTQF SW:ID YLZ6_CAEEL SW:DE RecName: Full=Putative esterase F42H10.6; EC=3.1.2.-; SW:GN ORFNames=F42H10.6; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->169|YLZ6_CAEEL|9e-94|100.0|169/169| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 27->151|3f5oC|3e-26|42.4|125/137| RP:PDB:NREP 1 RP:PDB:REP 28->153|3b7kA|3e-15|16.0|125/267| RP:PFM:NREP 1 RP:PFM:REP 69->137|PF03061|6e-10|46.3|67/79|4HBT| HM:PFM:NREP 2 HM:PFM:REP 69->143|PF03061|3.8e-19|36.0|75/79|4HBT| HM:PFM:REP 37->69|PF04164|9e-05|30.3|33/88|DUF400| RP:SCP:NREP 1 RP:SCP:REP 28->156|2hboA1|2e-19|18.3|126/142|d.38.1.5| HM:SCP:REP 27->155|1zkiA1|3.9e-25|32.0|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 120 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----211------1-1-1111-12-11-------------------11121221--1-1-----------------------------------1----11--21--11-111111-111111111111121-111111-2-111112-11-111112122-1-1-121--231---1-A111-----2111------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 88.8 SQ:SECSTR ##########HHccccTTcccccEEEEHHHHHHHHHHHHHHHHHHccccccccEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTccccccEEEEEccEEccccccTTcEEEEEEEEEEEETTEEEEEEEEEEETcHHHHHHTccEEEEcccccT######### DISOP:02AL 1-17, 168-169| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHcccEEEEEcccEEEEEEEEcHHHHccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccccEEEEEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccc //