[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F46G10.2
DDBJ      :             Protein kinase C terminal domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:607 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   404->462 PF08357 * SEFIR 2e-04 27.6 %
:HMM:PFM   395->460 PF08357 * SEFIR 7.9e-05 27.7 65/150  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA90543.2 GT:GENE F46G10.2 GT:PRODUCT Protein kinase C terminal domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE31521 WP:PRODUCT Protein kinase C terminal domain WP:LOCUS WBGene00009797 GB:PROTEIN_ID CAA90543.2 LENGTH 607 SQ:AASEQ MNGSKKYNTSGHSTTTVFISHSMLAVLTTVLFLAPATGADTVCSFNGNGTCSVNTDTDGIIEILNENNSTVNWKIRPQNIGFMYYVTTSGDGDDLIVKGIVKWKVQLKNWSTNDTVVEGFLVTIMDHDTNETVTTYQLTLSEPFEHFAERNDVMEMRLELDDVLSFDKRYDAKINILPIGKQAAASSFLSIMGKLEGEKCSAMTGLAERWAPHVMVELYETTSDIQLSWKAAPQFLCVKTYEVILQNRDGRIINTSEVKVNLGQKIANATFHGIERNQMVQVKVRGKNAIDGGCACVNCNCITDKTKFFVIPSLAKVTPPAPTSPTAVHHETLILSPLQIFFIFTGVVSLLLLLAFGWLCCNKYRKTIFKQKIAFSALKSSQYPNRKTKPKKAFKVMLVCPEVSGRDEDFMMRIADALKKSNNKVVCDRWFEDSKNAEENMLHWVYEQTKIAEKIIVFHSAYYHPRCGIYDVINNFFPCTDPRLAHIALTPEAQRSVPKEVEYVLPRDQKLLEDAFDITIADPLVIDIPIEDVAIPENVPIHHESCDSIDSRNNSKTHSTDSGVSSLSSNSSHSGGDNETLTSGMPTHLRDLNIEAHPLLRQPVEVV TM:NTM 3 TM:REGION 15->37| TM:REGION 293->315| TM:REGION 334->356| SEG 318->327|tppaptspta| SEG 350->354|lllll| SEG 559->576|stdsgvsslssnsshsgg| RP:PFM:NREP 1 RP:PFM:REP 404->462|PF08357|2e-04|27.6|58/146|SEFIR| HM:PFM:NREP 1 HM:PFM:REP 395->460|PF08357|7.9e-05|27.7|65/150|SEFIR| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 547-580| PSIPRED ccccEEEcccccEEEEEEHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEEcccHHHHHHHHccccEEEEEEEEccEEEEEEEEEccccccEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEEEEccHHHHHHcccccEEEEEEEHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHcccccHHHccHHHHccccEEEHHHHcccEEEEEEcccccEEEEEEEEEEEEcccccEEEcEEEEEEcccccccccccccccccEEEEEEEccccccccEEEEEcEEEccccEEEEEEHHHEEccccccccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHEEEEEEEccccccccHHHHHHHHHccccccEEEEEEEccHHHHccccHHHEEccccHHHHHHHHccEEcccEEEEcccccEEcccccccccccHHHcccccccccccccHHHHHHccccccccccccccccccccHHHcccccccHHHcccHHcc //