[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F47B7.1
DDBJ      :             protein-tyrosine phosphatase
Swiss-Prot:YV31_CAEEL   RecName: Full=UPF0057 membrane protein F47B7.1;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->56 PF01679 * UPF0057 1.7e-21 42.0 50/51  
:BLT:SWISS 1->59 YV31_CAEEL 7e-21 100.0 %
:PROS 12->27|PS01309|UPF0057
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAA80373.1 GT:GENE F47B7.1 GT:PRODUCT protein-tyrosine phosphatase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE02743 WP:PRODUCT protein-tyrosine phosphatase WP:LOCUS WBGene00018532 GB:PROTEIN_ID AAA80373.1 LENGTH 59 SQ:AASEQ MAIEMQQIIELILAIFLPPLAIFIHGNDCNMHVAVNIILCFFFFVPAVIHALWYCFFRA SW:ID YV31_CAEEL SW:DE RecName: Full=UPF0057 membrane protein F47B7.1; SW:GN ORFNames=F47B7.1; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->59|YV31_CAEEL|7e-21|100.0|59/59| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 12->27|PS01309|UPF0057|PDOC01013| TM:NTM 2 TM:REGION 4->25| TM:REGION 34->56| SEG 8->24|iielilaiflpplaifi| HM:PFM:NREP 1 HM:PFM:REP 6->56|PF01679|1.7e-21|42.0|50/51|UPF0057| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //