[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : F48C5.1
DDBJ      :             IG (immunoglobulin) superfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.1.1g.3.11
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->105 3i84B PDBj 1e-04 42.9 %
:RPS:PDB   46->107 1e0oB PDBj 5e-04 23.0 %
:RPS:SCOP  46->107 1olzA1  b.1.1.4 * 3e-04 16.4 %
:HMM:SCOP  46->114 1f2qA2 b.1.1.4 * 4.6e-05 30.0 %
:HMM:SCOP  124->177 1p9jA_ g.3.11.1 * 5.3e-06 22.2 %
:HMM:PFM   49->107 PF00047 * ig 6.8e-07 22.4 58/64  
:HMM:PFM   181->238 PF07204 * Orthoreo_P10 9.2e-05 24.1 58/98  
:BLT:SWISS 46->121 TITIN_DROME 3e-05 30.7 %
:BLT:SWISS 138->183 STAB2_RAT 2e-05 53.7 %
:PROS 156->167|PS00022|EGF_1
:PROS 156->167|PS01186|EGF_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA92132.1 GT:GENE F48C5.1 GT:PRODUCT IG (immunoglobulin) superfamily GT:ORG cele0 GT:DATABASE WS208 WP:CE CE03360 WP:PRODUCT IG (immunoglobulin) superfamily WP:LOCUS WBGene00009842 GB:PROTEIN_ID CAA92132.1 LENGTH 264 SQ:AASEQ MSGQSIINRIAQIFIFLCAVIQVTNAGEHILRLQEGTHTGTTLIGVEQGSSVLIRCEHPNGKVASLRWLRGGSPIKSEYVKTKKDASFVEITNYLPDKDNGVYECSAPGMSASYRLKGEKKHILPEGFRYCYGEEMASCKHADQCLVETSTGHFSCLCEVGWTGAACDMISEPPVRVDSVVTPPVCAYWPPVVTLLVFIVIIVLLAYCLYKFKVRNPHHYSKYSTTTINNNNTISKPPMVSGEYTPVHQHPPGQRNGDTIANMV BL:SWS:NREP 2 BL:SWS:REP 46->121|TITIN_DROME|3e-05|30.7|75/18141| BL:SWS:REP 138->183|STAB2_RAT|2e-05|53.7|41/1431| PROS 156->167|PS00022|EGF_1|PDOC00021| PROS 156->167|PS01186|EGF_2|PDOC00021| TM:NTM 2 TM:REGION 6->28| TM:REGION 182->204| SEG 192->205|vvtllvfiviivll| SEG 225->234|tttinnnnti| BL:PDB:NREP 1 BL:PDB:REP 36->105|3i84B|1e-04|42.9|63/85| RP:PDB:NREP 1 RP:PDB:REP 46->107|1e0oB|5e-04|23.0|61/197| HM:PFM:NREP 2 HM:PFM:REP 49->107|PF00047|6.8e-07|22.4|58/64|ig| HM:PFM:REP 181->238|PF07204|9.2e-05|24.1|58/98|Orthoreo_P10| RP:SCP:NREP 1 RP:SCP:REP 46->107|1olzA1|3e-04|16.4|61/91|b.1.1.4| HM:SCP:REP 46->114|1f2qA2|4.6e-05|30.0|60/89|b.1.1.4|1/1|Immunoglobulin| HM:SCP:REP 124->177|1p9jA_|5.3e-06|22.2|54/0|g.3.11.1|1/1|EGF/Laminin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 27.3 SQ:SECSTR ###################################TcccccEEEEEcTTccEEEEccEEcccccEEEEEEccEEEEcTTTccHHHHTEEEETTccccGccEEEEEEE############################################################################################################################################################# DISOP:02AL 1-5, 249-260| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccHHEEEEcccccccEEEEEEEcccEEEEEEEcccccEEEEEEEEcccEEcHHHHHHcccccEEEEEcccccccccEEEEccccccEEEEEccccEEEccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEccccccHHHcccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHEEEccccccccEEEEEEccccccccccccccccccccccccccccccHHHHcc //