[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : K07F5.9
DDBJ      :             protein-tyrosine phosphatase
Swiss-Prot:SSP10_CAEEL  RecName: Full=Sperm-specific class P protein 10;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.1.11
:109 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->109 1rowA PDBj 7e-43 97.2 %
:RPS:PDB   2->77 3dosA PDBj 1e-10 11.8 %
:RPS:SCOP  3->77 1m1sA  b.1.11.2 * 5e-12 48.0 %
:HMM:SCOP  3->109 1rowA_ b.1.11.2 * 8.9e-31 34.6 %
:HMM:PFM   3->96 PF00635 * Motile_Sperm 2.3e-27 40.4 94/109  
:BLT:SWISS 1->109 SSP10_CAEEL 1e-44 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA94274.1 GT:GENE K07F5.9 GT:PRODUCT protein-tyrosine phosphatase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE06124 WP:PRODUCT protein-tyrosine phosphatase WP:LOCUS WBGene00006039 GB:PROTEIN_ID CAA94274.1 LENGTH 109 SQ:AASEQ MSLTADPPACTVPAAGGSSTHKLVNGGAEKIIFKIKSSNNNEYRIAPVFGFVDPSGSKDVVITRTAGAPKEDKLVIHFAPAPADATDAQAAFAAVTPAGTVTIPMSATA SW:ID SSP10_CAEEL SW:DE RecName: Full=Sperm-specific class P protein 10; SW:GN Name=ssp-10; ORFNames=K07F5.9; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->109|SSP10_CAEEL|1e-44|100.0|109/109| SEG 78->98|fapapadatdaqaafaavtpa| BL:PDB:NREP 1 BL:PDB:REP 3->109|1rowA|7e-43|97.2|107/107| RP:PDB:NREP 1 RP:PDB:REP 2->77|3dosA|1e-10|11.8|76/201| HM:PFM:NREP 1 HM:PFM:REP 3->96|PF00635|2.3e-27|40.4|94/109|Motile_Sperm| RP:SCP:NREP 1 RP:SCP:REP 3->77|1m1sA|5e-12|48.0|75/109|b.1.11.2| HM:SCP:REP 3->109|1rowA_|8.9e-31|34.6|107/0|b.1.11.2|1/1|PapD-like| OP:NHOMO 26 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------6K-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 99.1 SQ:SECSTR #cEEEcccEEEEETTcccEEEEEEEcccccEEEEEEEEEcccEEEEccEEEEcTTcEEEEEEEEccccccccccEEEEEEccTTcccHHHHHTTccccEEEEEEEEEEc PSIPRED cEEEEEccccEEEccccEEEEEEEEcccccEEEEEEcccccEEEEccccEEEcccccEEEEEEEcccHHHccEEEEEEEEcccccccHHHHHHccccccEEEEEEEEEc //