[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : K09E4.1
DDBJ      :             sugar transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:367 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  52->328 1csnA_ d.144.1.7 * 2.4e-18 19.3 %
:BLT:SWISS 149->285 TTBK1_MOUSE 1e-11 30.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB70168.1 GT:GENE K09E4.1 GT:PRODUCT sugar transporter GT:ORG cele0 GT:DATABASE WS208 WP:CE CE19994 WP:PRODUCT sugar transporter WP:LOCUS WBGene00010719 GB:PROTEIN_ID CAB70168.1 LENGTH 367 SQ:AASEQ MDTMEQHQELEQEAIGPALPPPSAAQKSELFEEHNVEYELINGIPCYQPDHVVDGQVQIFERIGYDDKVGGTFLGLSADGKELVVRVAPIDALTHVVRAEAAFLCKVEAELQDWRLFSQVHKIFLTDDAWHMSLYFRGGPTLEQCFAMRNKFTLGTAGRLAEDVLNVIRCAHKHGYLVRNMDLNSFHYDAASRHLFMADISSLVKNISGDDGAPIASYAGCLDYAPCSDDGLVGARQDLETWFYQLVHLVLGELPWGSLSREEAGVKKAEFQKSKEFAELPEVFHKIAEVVIAKEYSVVEEEEYVKLAGLTEQIYKELGGVTDHEENMDFEREPTPDELPRFVACRADEIPTIAEEEEPAVEEENSE BL:SWS:NREP 1 BL:SWS:REP 149->285|TTBK1_MOUSE|1e-11|30.7|137/1308| SEG 295->305|eysvveeeeyv| SEG 349->364|eiptiaeeeepaveee| HM:SCP:REP 52->328|1csnA_|2.4e-18|19.3|269/0|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 57 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------1----1-541313811213-1---1211-11-----21221-----1-------23-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-50, 339-367| PSIPRED cccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEccEEEEEEEEcccccEEEEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccEEEEEEEcccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHEEEcccccEEEEEEEHHHHHHcccccccccccEEccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccccEEcccHHHHHHHHHccccHHHHHHHHHHHHccccccc //