[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : M88.2
DDBJ      :             serine\/threonine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 37->141 RT34_MOUSE 7e-08 30.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA84334.2 GT:GENE M88.2 GT:PRODUCT serine\/threonine kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE23884 WP:PRODUCT serine\/threonine kinase WP:LOCUS WBGene00010905 GB:PROTEIN_ID CAA84334.2 LENGTH 228 SQ:AASEQ MSSNLIRFVGNHDIASEGKFLFEILSQLRNFGVGRLVTKNEWTRKWPNNPSYMKILRAEPGMDRWLFEGKVYAEWVFRGKNLGVYEFSKDLNRSDWQLVHKHQEKSYTSSTTPMQDLVLPDSFPLPPLQVHLSQKSARKNGLDEKTVSRRAPLTLSVDPEFQHLKPFIKQEAPSTKSVSIYEEVDKNALLDLYGNELPVKVEAWNAGPAMFQPRFNATTMRVEEQPPK BL:SWS:NREP 1 BL:SWS:REP 37->141|RT34_MOUSE|7e-08|30.7|101/218| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------1------1----------------------------------1-1-1112-11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 137-141, 223-228| PSIPRED cccccEEEEccEEEccccccHHHHHHcccccccEEEEEEHHHHHHccccccEEEEEEEEccccccccccEEEEEEEEEccccccEEEEEEHHccccEEccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEcccHHHHHHHHHHcccccccEEHHHHHccccEEEEccccccEEEEEEcccccEEccccccEEEEEcccccc //