[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : R01E6.4
DDBJ      :             NADH dehydrogenase ND4L
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  65/199 : Viruses  0/175   --->[See Alignment]
b.96.1f.36.1
:573 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->356,493->538 2bg9A PDBj 2e-63 45.0 %
:RPS:PDB   38->381 2bg9E PDBj 4e-70 29.4 %
:RPS:PDB   493->519 2bg9A PDBj 1e-06 40.7 %
:RPS:SCOP  44->263 1i9bA  b.96.1.1 * 3e-40 24.9 %
:RPS:SCOP  265->367 1oedA  f.36.1.1 * 1e-26 37.6 %
:HMM:SCOP  36->264 1i9bA_ b.96.1.1 * 4.5e-63 45.9 %
:HMM:SCOP  264->551 1oedE_ f.36.1.1 * 1e-56 35.2 %
:RPS:PFM   40->264 PF02931 * Neur_chan_LBD 1e-49 50.7 %
:RPS:PFM   271->539 PF02932 * Neur_chan_memb 3e-33 40.5 %
:HMM:PFM   38->264 PF02931 * Neur_chan_LBD 9.5e-74 44.7 215/216  
:HMM:PFM   271->536 PF02932 * Neur_chan_memb 8.1e-49 34.7 222/237  
:BLT:SWISS 12->566 ACH4_DROME e-106 43.7 %
:PROS 162->176|PS00236|NEUROTR_ION_CHANNEL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA92184.2 GT:GENE R01E6.4 GT:PRODUCT NADH dehydrogenase ND4L GT:ORG cele0 GT:DATABASE WS208 WP:CE CE29334 WP:PRODUCT NADH dehydrogenase ND4L WP:LOCUS WBGene00000051 GB:PROTEIN_ID CAA92184.2 LENGTH 573 SQ:AASEQ MLYKKRLQMFSFNWALILLVAVGGTNAFKIKRTAKDLESQLYEDLLFDYNKVPRPVKNSSDILTVDVGASLIRIIDVDEKNQVLTTNLWLEMKWNDAKLTWTPEKYGGLKTLHIPSDFIWTPDLVLYNNAAGDPDITILTDALVTFEGNVYWQPPAIYKSFCPIDVTWFPYDSQKCEMKFGTWTYTGRYVDLKQLPQEEVVTITKDDNDVEFMQQGMDLSFFYRSAEWDLLSLTSERHSVLYASCCGPEKYVDITYYFGLRRKTLFFTCNLILPCFLISILTTFVFYLSDHKITFSISILVTLTVFFLVLIDLMPPTSLVIPMFGRYLITTMILVALSTVVSVITVNFRFRSGSAHKMSPWIRAVFLKFLPKILLMSRPEKGEVTKQPPLVNAASLVGSNYATAAKAANEYRNKAKGKNNDLMSLRGKPSSQAVLNNTFDMRMRNNDSTVENRLKPYLCAQNNNAPTVAFRKTKRQKSKSVDDVVFMNLLNQVRFIAEHFRHNELEGEISDDWTFVAMVLDRLFLIIFSVLNVGTVFIILESPSLYDYSKPMNITVPNKPLGQANFYSSWNLK BL:SWS:NREP 1 BL:SWS:REP 12->566|ACH4_DROME|e-106|43.7|494/519| PROS 162->176|PS00236|NEUROTR_ION_CHANNEL|PDOC00209| TM:NTM 5 TM:REGION 9->29| TM:REGION 265->287| TM:REGION 297->319| TM:REGION 326->347| TM:REGION 517->539| SEG 300->310|lvtltvfflvl| BL:PDB:NREP 1 BL:PDB:REP 38->356,493->538|2bg9A|2e-63|45.0|346/370| RP:PDB:NREP 2 RP:PDB:REP 38->381|2bg9E|4e-70|29.4|326/370| RP:PDB:REP 493->519|2bg9A|1e-06|40.7|27/370| RP:PFM:NREP 2 RP:PFM:REP 40->264|PF02931|1e-49|50.7|203/206|Neur_chan_LBD| RP:PFM:REP 271->539|PF02932|3e-33|40.5|215/221|Neur_chan_memb| HM:PFM:NREP 2 HM:PFM:REP 38->264|PF02931|9.5e-74|44.7|215/216|Neur_chan_LBD| HM:PFM:REP 271->536|PF02932|8.1e-49|34.7|222/237|Neur_chan_memb| GO:PFM:NREP 5 GO:PFM GO:0005230|"GO:extracellular ligand-gated ion channel activity"|PF02931|IPR006202| GO:PFM GO:0006810|"GO:transport"|PF02931|IPR006202| GO:PFM GO:0016020|"GO:membrane"|PF02931|IPR006202| GO:PFM GO:0006811|"GO:ion transport"|PF02932|IPR006029| GO:PFM GO:0016020|"GO:membrane"|PF02932|IPR006029| RP:SCP:NREP 2 RP:SCP:REP 44->263|1i9bA|3e-40|24.9|197/205|b.96.1.1| RP:SCP:REP 265->367|1oedA|1e-26|37.6|101/127|f.36.1.1| HM:SCP:REP 36->264|1i9bA_|4.5e-63|45.9|205/205|b.96.1.1|1/1|Nicotinic receptor ligand binding domain-like| HM:SCP:REP 264->551|1oedE_|1e-56|35.2|256/260|f.36.1.1|1/1|Neurotransmitter-gated ion-channel transmembrane pore| OP:NHOMO 2156 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1--11--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------A-*kwqzjVHDHIIQKZbJXI**U-dOrFLECYHNVJBMIHGOIBaIYHNSEISm**HBNDEdoyx------------------------2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 402 STR:RPRED 70.2 SQ:SECSTR #############################HHHHHHccHHHHHHHHHHHccccccccccccccccEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEcGGGcccTTTTTTcccccccGGGcccccEEEccccccccccccccccEEccccEEEEccEEEEEEcccccccccccccccccEEEEEccccTTcccEEcccccccEEccccccccEccEcccGGGcccTTccEEEEEccccEEccccETTcccccccEEEEccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHTTccTTTccHHHHHHHHHHHHHHHHHHHHHHHH###############################################################################################################HHHHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHHH############################### DISOP:02AL 377-434, 442-480| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEccEEEccccccccccccccHHHHcccEEEEEEEccccccccEEEEEEEEcccEEEEEccEEEEEEEEEEEEEccccccEEEEEEEEEccccEEEEEEEccccccEEEEccccccEEEEEcccHHHHEEcccEEEEEEEEEEEEEEEccccccccEEEEEEEEEEEEcccEEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc //