[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : R10D12.1
DDBJ      :             sodium\/phosphate transporter
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  166/915 : Eukaryota  85/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->334 1pw4A PDBj 3e-04 21.1 %
:RPS:SCOP  90->233 1pv6A  f.38.1.2 * 9e-06 17.6 %
:RPS:SCOP  295->477 1pv6A  f.38.1.2 * 4e-08 17.6 %
:HMM:SCOP  20->457 1pw4A_ f.38.1.1 * 7.6e-55 21.0 %
:RPS:PFM   81->398 PF07690 * MFS_1 6e-16 26.2 %
:HMM:PFM   46->420 PF07690 * MFS_1 1.9e-43 20.5 336/353  
:HMM:PFM   394->473 PF07690 * MFS_1 9.4e-09 19.7 76/353  
:BLT:SWISS 111->469 YLD2_CAEEL 3e-37 27.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB03245.1 GT:GENE R10D12.1 GT:PRODUCT sodium\/phosphate transporter GT:ORG cele0 GT:DATABASE WS208 WP:CE CE12672 WP:PRODUCT sodium\/phosphate transporter WP:LOCUS WBGene00011185 GB:PROTEIN_ID CAB03245.1 LENGTH 485 SQ:AASEQ MTADKVAPLPQKGVAVAIPDTKSSNDDSKDQPGYVRYLIMISTMLCLTSLMSNVVCFNFTVLCMPGSGETGELVGNRTHFVGYTRQEKTVLLSTVAIGAVCGVFPVIIGISKLGLKKVFMTSGVLTAISTFLIPILAPLHFHLFIMLRFVQGLSYAACFPAVGAITSSWASLAQQGLFIAALTTFGQTSSIFSMPVAGELCTSVFGWKSVFYLHAIISLVVFTIWFALFTDSPEDNKLVRPAELAEIEFGKSEDEIHEHSNTPYLEILTTPSVWGIWIGAFGDLIAVQLIHIYSPVFLHDVGGYSFEKTGFAAAVPVLFQFFVKMFAGHSSDKVHGISETTKLRIYNTIALGASAIFLVSLGFVKQGQGVLGLVLMTLATGMFGFNGGGFSKCAALVSRQYNHFVMAIQQILVCLSMIVCPIIVSTILQHGTTAEWRIVFFVHAAILLICNAIFCWLATAKPAPWTDRTIKHSATKNTPLYQTKV BL:SWS:NREP 1 BL:SWS:REP 111->469|YLD2_CAEEL|3e-37|27.2|356/493| TM:NTM 11 TM:REGION 40->62| TM:REGION 90->112| TM:REGION 119->141| TM:REGION 145->167| TM:REGION 176->198| TM:REGION 211->233| TM:REGION 272->294| TM:REGION 344->366| TM:REGION 372->394| TM:REGION 406->428| TM:REGION 438->460| BL:PDB:NREP 1 BL:PDB:REP 82->334|1pw4A|3e-04|21.1|237/434| RP:PFM:NREP 1 RP:PFM:REP 81->398|PF07690|6e-16|26.2|290/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 46->420|PF07690|1.9e-43|20.5|336/353|MFS_1| HM:PFM:REP 394->473|PF07690|9.4e-09|19.7|76/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 2 RP:SCP:REP 90->233|1pv6A|9e-06|17.6|142/417|f.38.1.2| RP:SCP:REP 295->477|1pv6A|4e-08|17.6|176/417|f.38.1.2| HM:SCP:REP 20->457|1pw4A_|7.6e-55|21.0|415/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1092 OP:NHOMOORG 252 OP:PATTERN ---------------------------------------------------------------1---- --2-------1-1------------1----------------------------1-----------2------------------------------------------------------------------------------------------------------------------------------111111--1-1----1--44-1-----1------------111111111111111111-1-------------------1------------------------------------------------------1------------11--------------1--1-----1---------1---1-----1--11--1-1-------------1------2-3----1--1--------2-1--------------------1-----------------------------------------------6777631----5573-----2632-421--112-----1------------1-------------1-------------------------------------------------------------2----------------------------------------1-31-213332322233-332332132333233333123312---2121323333123211111-3332------------------------------------1----------11-1--1---2-----2-43-2122-223---------------------------2-22------------------------------------------------------------------ -----21----------------------------------------------------------------------------------------------------1--SC879886432674I9283Ia9-C7F4532B268756424A33E446538DC5AOD9WEFir*C3131-8-11112586-621-111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 237 STR:RPRED 48.9 SQ:SECSTR #################################################################################TTccccHHHHHHHHHHHHHHHHH#HHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHTHHHH####HHHHHTTcTTTHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHTcccTTcTHHHHHHHHHHHHHHHHHcccccTT######TcccccTTTcccc#####cTHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHT####################################################################################################################################################### DISOP:02AL 1-4, 8-17, 253-257, 465-478| PSIPRED cccccccccccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHccccccccccc //