[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : R53.5
DDBJ      :             ATP synthase complex f subunit like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   67->217 2b7jB PDBj 5e-06 11.7 %
:RPS:SCOP  25->113 2b5xA1  c.47.1.10 * 7e-05 13.9 %
:HMM:SCOP  23->214 1hd2A_ c.47.1.10 * 2.1e-05 18.8 %
:HMM:PFM   31->112 PF08534 * Redoxin 5.7e-07 30.3 66/146  
:BLT:SWISS 52->213 CJ058_MOUSE 4e-30 43.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA91349.1 GT:GENE R53.5 GT:PRODUCT ATP synthase complex f subunit like protein GT:ORG cele0 GT:DATABASE WS208 WP:CE CE03575 WP:PRODUCT ATP synthase complex f subunit like protein WP:LOCUS WBGene00011274 GB:PROTEIN_ID CAA91349.1 LENGTH 219 SQ:AASEQ MAFLGYGAAAALGGALVYANLPTYLTIGAVAPTFAHLAAAKLVPIRGGPKEKEVVERNEQFTADSLFKKGPIMVMAVRRPGCMLCRREAAELHTLLPLLKEKGIELAAVVHETRGANEFKSWFSGGDVYLDTDRTFYGPNERWLPVWMGFLRFGTYSNVYKAKKAKVEGNMEGEGRLLGGVYLIANNDIVFTHLEKEWGDAADIKEVRAAVEKFSEKSK BL:SWS:NREP 1 BL:SWS:REP 52->213|CJ058_MOUSE|4e-30|43.1|160/218| SEG 2->21|aflgygaaaalggalvyanl| RP:PDB:NREP 1 RP:PDB:REP 67->217|2b7jB|5e-06|11.7|145/181| HM:PFM:NREP 1 HM:PFM:REP 31->112|PF08534|5.7e-07|30.3|66/146|Redoxin| RP:SCP:NREP 1 RP:SCP:REP 25->113|2b5xA1|7e-05|13.9|72/143|c.47.1.10| HM:SCP:REP 23->214|1hd2A_|2.1e-05|18.8|154/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 83 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----1--------1-----------------------------------------------------------------------------------------------23241311-111112111-671-11111113-111-112-111212--1--11--------111--11-------4--2--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 75.3 SQ:SECSTR ####################################################EEEcTTccEEEGGGGTTccEEEEEEcTTcccHHHHHHHHHHHHHHHHHHHTccccEEEEEEccTTTccHTTccHHHHHHHHHTTccTTcEEEEccHHHHHHHHHTTccccccccccTTccccccccccEEEEcTTccEEEEEcTTccHHHHHHHHHHHHHTccTT## DISOP:02AL 215-219| PSIPRED ccccHHHHHHHHHHHHHEEEHHHHcccccccHHHHHHHcccEEEcccccEEEEEcccccEEEHHHHHHHccEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEcccHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccEEEEccEEEEEcccEEEEEEEccccccccHHHHHHHHHHHccccc //