[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : T05E12.3
DDBJ      :             haemoglobinase like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  59/199 : Viruses  0/175   --->[See Alignment]
d.42.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->111 3drzD PDBj 5e-08 39.3 %
:RPS:PDB   22->112 2a79B PDBj 4e-14 19.8 %
:RPS:SCOP  22->105 1a68A  d.42.1.2 * 3e-10 23.8 %
:HMM:SCOP  20->119 1t1dA_ d.42.1.2 * 9.9e-20 31.0 %
:RPS:PFM   22->111 PF02214 * K_tetra 5e-08 34.8 %
:HMM:PFM   22->112 PF02214 * K_tetra 4.6e-19 40.0 90/94  
:BLT:SWISS 22->163 KCD10_RAT 1e-14 34.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB04686.1 GT:GENE T05E12.3 GT:PRODUCT haemoglobinase like GT:ORG cele0 GT:DATABASE WS208 WP:CE CE23948 WP:PRODUCT haemoglobinase like WP:LOCUS WBGene00011486 GB:PROTEIN_ID CAB04686.1 LENGTH 261 SQ:AASEQ MIVKFSIIFLIFFIFRLQAQEIKLYVGGTEFTTSIKTLLNTESALKNYVVRYELKTERTPELITIDRSPKHFDTILNFLRDGDVPLPVNELVLAEVRQEAEFFRLNGLIQLCDVKSATVKKVTISDCEAKNVFKDHFKPAIINDDQKMVEILANIDKKPVLIVSFYIPRNGLIHFPSGFTFKTFVELYQNRLDVYFKVTHYATDDEQPTSNWSFGIYGKRKDCDIIRSGPLLNFMADLEEKIQQYFAKEEEEERKLEIVIE BL:SWS:NREP 1 BL:SWS:REP 22->163|KCD10_RAT|1e-14|34.6|130/315| TM:NTM 1 TM:REGION 1->21| SEG 2->15|ivkfsiifliffif| SEG 248->260|keeeeerkleivi| BL:PDB:NREP 1 BL:PDB:REP 22->111|3drzD|5e-08|39.3|84/95| RP:PDB:NREP 1 RP:PDB:REP 22->112|2a79B|4e-14|19.8|91/259| RP:PFM:NREP 1 RP:PFM:REP 22->111|PF02214|5e-08|34.8|89/91|K_tetra| HM:PFM:NREP 1 HM:PFM:REP 22->112|PF02214|4.6e-19|40.0|90/94|K_tetra| GO:PFM:NREP 4 GO:PFM GO:0005249|"GO:voltage-gated potassium channel activity"|PF02214|IPR003131| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02214|IPR003131| GO:PFM GO:0008076|"GO:voltage-gated potassium channel complex"|PF02214|IPR003131| GO:PFM GO:0016020|"GO:membrane"|PF02214|IPR003131| RP:SCP:NREP 1 RP:SCP:REP 22->105|1a68A|3e-10|23.8|84/87|d.42.1.2| HM:SCP:REP 20->119|1t1dA_|9.9e-20|31.0|100/100|d.42.1.2|1/1|POZ domain| OP:NHOMO 165 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------23332313211332522324C3-334121243131-3221331222321111--31111-33R2------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 46.0 SQ:SECSTR ###############HHHTcEEEEEETTEEEEEEHHHHHTcTTcTTTcHHHHGGGEETTTTEEEEcccHHHHHHHHHHHHTTccccccTTccHHHHHHHHHHTTccHHHHHH##HHHHHHTHHHHcccccccEEEEE############################################################################################################################ DISOP:02AL 8-20,260-262| PSIPRED cEEEEEEEEEEEEEEcccccEEEEEEccEEEEEEcHHHccccHHHHHHHccccccccccccEEEEccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcHHHHHHHHHHccccEEEEEEEEcccccEEEccccccHHHHHHHccccEEEEEEEEccccccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccHHHHHEEEEEEc //