[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : W01G7.3
DDBJ      :             ribosomal protein L37
Swiss-Prot:RPB11_CAEEL  RecName: Full=Probable DNA-directed RNA polymerase II subunit RPB11;         Short=RNA polymerase II subunit B11;AltName: Full=DNA-directed RNA polymerase II subunit J;

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
d.142.2d.74.3
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->101 2r92K PDBj 3e-23 49.5 %
:RPS:PDB   1->114 2b63K PDBj 3e-21 44.7 %
:RPS:SCOP  6->110 1xdnA  d.142.2.4 * 6e-25 20.8 %
:HMM:SCOP  1->113 1i50K_ d.74.3.2 * 3e-33 49.6 %
:HMM:PFM   32->100 PF01193 * RNA_pol_L 1.2e-10 27.5 69/86  
:BLT:SWISS 1->122 RPB11_CAEEL 8e-68 100.0 %
:PROS 34->65|PS01154|RNA_POL_L_13KD

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB03455.1 GT:GENE W01G7.3 GT:PRODUCT ribosomal protein L37 GT:ORG cele0 GT:DATABASE WS208 WP:CE CE18986 WP:PRODUCT ribosomal protein L37 WP:LOCUS WBGene00012187 GB:PROTEIN_ID CAB03455.1 LENGTH 122 SQ:AASEQ MNAPAAFESFLLLDDKKFYIEKDTKVPNAAIFTIMKEDHTLGNMLKIQLLKDPEVLFAGYKNPHPLEHKILLRIQTTNNTTPADALTTAITDLVGELSLLEHRIDAAIKKCTQSGDQERGYN SW:ID RPB11_CAEEL SW:DE RecName: Full=Probable DNA-directed RNA polymerase II subunit RPB11; Short=RNA polymerase II subunit B11;AltName: Full=DNA-directed RNA polymerase II subunit J; SW:GN ORFNames=W01G7.3; SW:KW Complete proteome; DNA-directed RNA polymerase; Nucleus;Transcription. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->122|RPB11_CAEEL|8e-68|100.0|122/122| GO:SWS:NREP 3 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0005634|"GO:nucleus"|Nucleus| GO:SWS GO:0006350|"GO:transcription"|Transcription| PROS 34->65|PS01154|RNA_POL_L_13KD|PDOC00889| BL:PDB:NREP 1 BL:PDB:REP 1->101|2r92K|3e-23|49.5|101/112| RP:PDB:NREP 1 RP:PDB:REP 1->114|2b63K|3e-21|44.7|114/115| HM:PFM:NREP 1 HM:PFM:REP 32->100|PF01193|1.2e-10|27.5|69/86|RNA_pol_L| RP:SCP:NREP 1 RP:SCP:REP 6->110|1xdnA|6e-25|20.8|101/265|d.142.2.4| HM:SCP:REP 1->113|1i50K_|3e-33|49.6|113/114|d.74.3.2|1/1|RBP11-like subunits of RNA polymerase| OP:NHOMO 384 OP:NHOMOORG 190 OP:PATTERN --------------11---------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 21-1221-4112222222221222212222222222221222212111111121-122222121222222221222222222221122-12121112222212222-24142121131111-1142232GK4-A14-21231123111112112-233232113111111-222212228112-132322121122322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 93.4 SQ:SECSTR cccccGGGGTcccccccccEEEccccccEEEEEEEcccHHHHHHHHHHTTccTTEEEEEEEcccTTccEEEEEEEEcTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccc######## DISOP:02AL 1-3, 110-122| PSIPRED ccccccHHHHccccccEEEEEcccccccEEEEEEEcccccHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //