[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : W05B5.1
DDBJ      :             Kunitz\/Bovine pancreatic trypsin inhibitor domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   160->208 PF03285 * Paralemmin 1.1e-05 34.7 49/278  
:BLT:SWISS 166->208 PALM_PIG 1e-04 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB04917.1 GT:GENE W05B5.1 GT:PRODUCT Kunitz\/Bovine pancreatic trypsin inhibitor domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE19005 WP:PRODUCT Kunitz\/Bovine pancreatic trypsin inhibitor domain WP:LOCUS WBGene00012274 GB:PROTEIN_ID CAB04917.1 LENGTH 209 SQ:AASEQ MSLLMGFDTVELGSAYFLGENFEMAVFQPVFEEVCWFFIPDAPVSRVVVTSDTVIPEAPSPIPPPAQFEEVRRVAVSPPLPSKKMTDAENPFRPEEILYHEVDPIVEQYLHKPFPPSRPGSAQNTPTKQQHFTQAATPPPTNHESPLYLQNGLSKEQLVQNEKNEHGNHSEPLLAEHNRNEEYVEDLPPAGKVELIHVKKKKCGCCSVQ BL:SWS:NREP 1 BL:SWS:REP 166->208|PALM_PIG|1e-04|37.2|43/387| SEG 55->66|ipeapspipppa| HM:PFM:NREP 1 HM:PFM:REP 160->208|PF03285|1.1e-05|34.7|49/278|Paralemmin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 116-134, 157-170| PSIPRED ccccccccHHHHccEEEEcccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccHHHccccHHHHHHccccccccccccHHHHHcccHHHHHHccccccEEEEEEEcccccccccc //