[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y106G6D.6
DDBJ      :             serine\/threonine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
g.7.1
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  50->103 1bteA  g.7.1.3 * 7e-04 22.6 %
:HMM:PFM   13->66 PF06929 * Rotavirus_VP3 5e-05 29.6 54/684  
:HMM:PFM   66->81 PF08117 * Toxin_30 5.4e-05 50.0 16/35  
:BLT:SWISS 9->112 FBN1_MOUSE 5e-04 39.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA20979.2 GT:GENE Y106G6D.6 GT:PRODUCT serine\/threonine kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE41713 WP:PRODUCT serine\/threonine kinase WP:LOCUS WBGene00013702 GB:PROTEIN_ID CAA20979.2 LENGTH 130 SQ:AASEQ MNHRIVLIFYCIFSTFSISQAVLKCYTGYSIMKGSTIGTETKECGKETDFCYNGTADISSFSKFQKAGCNTVICQFHANKCFEQNVSGQLLTFCCCNTDDLCNGGAVTDSGSLFDRGLSVLKGLVSAGKK BL:SWS:NREP 1 BL:SWS:REP 9->112|FBN1_MOUSE|5e-04|39.2|79/2871| TM:NTM 1 TM:REGION 2->24| HM:PFM:NREP 2 HM:PFM:REP 13->66|PF06929|5e-05|29.6|54/684|Rotavirus_VP3| HM:PFM:REP 66->81|PF08117|5.4e-05|50.0|16/35|Toxin_30| RP:SCP:NREP 1 RP:SCP:REP 50->103|1bteA|7e-04|22.6|53/92|g.7.1.3| OP:NHOMO 8 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------35-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,128-131| PSIPRED cccHHHHHHHHHHHHHEEEEEEEEEEcccEEEEEEEEccccccccccccEEEEcHHHHHHHHHHHHccccEEEEEEEEcccEEEEEccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHccc //