[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y37D8A.10
DDBJ      :             Sugar (and other) transporters
Swiss-Prot:SPCS2_CAEEL  RecName: Full=Probable signal peptidase complex subunit 2;         EC=3.4.-.-;AltName: Full=Microsomal signal peptidase 25 kDa subunit;         Short=SPase 25 kDa subunit;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  69/199 : Viruses  0/175   --->[See Alignment]
a.7.12
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  106->177 1t72A  a.7.12.1 * 4e-04 19.4 %
:RPS:PFM   17->175 PF06703 * SPC25 8e-29 41.7 %
:HMM:PFM   17->174 PF06703 * SPC25 7.3e-51 36.3 157/161  
:BLT:SWISS 1->180 SPCS2_CAEEL e-105 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA21529.1 GT:GENE Y37D8A.10 GT:PRODUCT Sugar (and other) transporters GT:ORG cele0 GT:DATABASE WS208 WP:CE CE20214 WP:PRODUCT Sugar (and other) transporters WP:LOCUS WBGene00012550 GB:PROTEIN_ID CAA21529.1 LENGTH 180 SQ:AASEQ MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ SW:ID SPCS2_CAEEL SW:DE RecName: Full=Probable signal peptidase complex subunit 2; EC=3.4.-.-;AltName: Full=Microsomal signal peptidase 25 kDa subunit; Short=SPase 25 kDa subunit; SW:GN ORFNames=Y37D8A.10; SW:KW Complete proteome; Endoplasmic reticulum; Hydrolase; Membrane;Microsome; Protease; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->180|SPCS2_CAEEL|e-105|100.0|180/180| GO:SWS:NREP 6 GO:SWS GO:0005783|"GO:endoplasmic reticulum"|Endoplasmic reticulum| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0005792|"GO:microsome"|Microsome| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| RP:PFM:NREP 1 RP:PFM:REP 17->175|PF06703|8e-29|41.7|156/159|SPC25| HM:PFM:NREP 1 HM:PFM:REP 17->174|PF06703|7.3e-51|36.3|157/161|SPC25| GO:PFM:NREP 4 GO:PFM GO:0005787|"GO:signal peptidase complex"|PF06703|IPR009582| GO:PFM GO:0006465|"GO:signal peptide processing"|PF06703|IPR009582| GO:PFM GO:0008233|"GO:peptidase activity"|PF06703|IPR009582| GO:PFM GO:0016021|"GO:integral to membrane"|PF06703|IPR009582| RP:SCP:NREP 1 RP:SCP:REP 106->177|1t72A|4e-04|19.4|72/215|a.7.12.1| OP:NHOMO 82 OP:NHOMOORG 69 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----1-1-------1-----------------------------------------1----------------------------------------------1-1-1--2121111111121111131181112111-1111111111-1-11-111-111111111111111--------------1-1-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 135-143, 178-180| PSIPRED ccccccEEEccccHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEccEEEEEEccccccccEEEEEEEEcccccEEEEEEEEccccccccEEEEEEHHHEEccccEEEHHHHHHHHHHHHHHHHHccc //