[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y39H10A.6
DDBJ      :             protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
a.221.1b.69.11b.69.13b.69.4
:684 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   254->596 2o9kC PDBj 6e-07 21.3 %
:RPS:PDB   244->596 2cnxA PDBj 2e-17 17.4 %
:RPS:SCOP  58->110 1uujA  a.221.1.1 * 1e-04 17.3 %
:RPS:SCOP  254->282 1sqjA1  b.69.13.1 * 4e-04 6.9 %
:RPS:SCOP  264->596 1ri6A  b.69.11.1 * 2e-17 8.9 %
:HMM:SCOP  240->594 1gotB_ b.69.4.1 * 1.3e-35 21.3 %
:RPS:PFM   560->593 PF00400 * WD40 3e-04 44.1 %
:HMM:PFM   247->283 PF00400 * WD40 2e-08 29.7 37/39  
:HMM:PFM   558->594 PF00400 * WD40 4.3e-12 41.7 36/39  
:BLT:SWISS 25->593 WDR26_DROME 5e-39 27.2 %
:BLT:SWISS 564->604 HAT2_ASPFU 2e-04 43.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAK84605.2 GT:GENE Y39H10A.6 GT:PRODUCT protein kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE32248 WP:PRODUCT protein kinase WP:LOCUS WBGene00021482 GB:PROTEIN_ID AAK84605.2 LENGTH 684 SQ:AASEQ MTVDEQLDDVGRKGKKMSVAQRLQNHAQLSPRSQDDPEETESVIRKEIALGKYDKATIRIIAQFLDNIGLTSSVETLVEETGFTIETTSGARVRANILKGNYDAAIQILETSNDHITEETAKHGSYIVKCFKLADLVRKGRYFDALFTMQKMIRGVILDHSEHFDYFDTFFKDVLLGNCRYQNIDQVAERQSQLAFLEEILPSDFILPQNRLKTILNKVHGAAADEKAPKLLRDEPSNSVKTIPWRQTQLWDHHKFEIFCVKFSRNGKMMASGGKSNSITLWKCAKSKLTRIGEMAPINEGDIAYMEFCQQNKYLLICGGQMARYNLTIFDIATRSVFRMLRVNNTHDDIIDIGSFFSCGSFLTDTYNRTRVVAGNEFGAMKVFDLSRGEHEPAIRQQAGFRIRCLHGMRSGDSFIAVDTHNRVRLFSFANNTTENLEGTTICKEEVTIIHMTVHPSERLVLTTTELNLRLWDIRTHNLIRIFSGACQREEFSRYQIHSSFGGVHQNFIATGSIGSSFFLFHLFSSQGRNRRIATRNDKTKRKHGRVVIWSVQDSRPRYSLVGHRGHVNAVAWNPADPTMLVSCGADATIRVWSLDRSETADYSEIVPRRIPRHLKQQKKSSSSMVQCDMMEPSTSKNGGGTYELCTNMKEMLSTKSEFESDLKQEQEWLNQAARPDWILDNND BL:SWS:NREP 2 BL:SWS:REP 25->593|WDR26_DROME|5e-39|27.2|515/630| BL:SWS:REP 564->604|HAT2_ASPFU|2e-04|43.9|41/436| SEG 516->526|ssfflfhlfss| SEG 616->624|kqqkkssss| BL:PDB:NREP 1 BL:PDB:REP 254->596|2o9kC|6e-07|21.3|287/303| RP:PDB:NREP 1 RP:PDB:REP 244->596|2cnxA|2e-17|17.4|298/306| RP:PFM:NREP 1 RP:PFM:REP 560->593|PF00400|3e-04|44.1|34/39|WD40| HM:PFM:NREP 2 HM:PFM:REP 247->283|PF00400|2e-08|29.7|37/39|WD40| HM:PFM:REP 558->594|PF00400|4.3e-12|41.7|36/39|WD40| RP:SCP:NREP 3 RP:SCP:REP 58->110|1uujA|1e-04|17.3|52/76|a.221.1.1| RP:SCP:REP 254->282|1sqjA1|4e-04|6.9|29/427|b.69.13.1| RP:SCP:REP 264->596|1ri6A|2e-17|8.9|305/333|b.69.11.1| HM:SCP:REP 240->594|1gotB_|1.3e-35|21.3|296/0|b.69.4.1|1/1|WD40 repeat-like| OP:NHOMO 114 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------1------------111111---11111111111----------------------------------------1-------1-----------1--233233211-1-1121-11281-1121-1-1111111--11-12-1111--21111182112111--------111-11-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 493 STR:RPRED 72.1 SQ:SECSTR ##################################################################################################################cHHHHHHHHHTccHH##HHTTccHHHHHHHHH###HHHHHHTTcccHHHHHHHHHHHcTTccccccccHH##HHHHHHHHHHHccccccccccTTcEEEEccccccccccccGGGTHHHcccccccEEEcccccEEEccccccEEEEEEcTTccEEEEEETTcEEEEEETTTccEEEEEEccccccccEEEEEEcTTccEEEEEETTTcccEEEEEEccccETTcEEEEEETTTTEEEEEEEcccccEEEEEEcTTccEEEEEETTccEEEEETTTccEEEEEccccccEEEEEEcTTccEEEEEETTccEEEEETTTccEEEEEEccccccEEEEEEEEcTTccEEEEETTTEEEEEETTTTEEEEEEccEEEccccccccccEEEEcccccEEEEccEcTTEEEEcEEEEEccEEEEEETTcccccTTccEEEEETTTccEEEEEccccccEEEEEEcccccEEEEEcTTTccEEEEEccEEEEEEEEcccccccccE###################################################################### DISOP:02AL 3-48, 110-124, 601-623, 632-661, 682-684| PSIPRED cccccccccccccccEEEEEEHHHccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHccEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHEEEEEEccccEEEEcccccEEEEcccEEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEEcccccccEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEEccccccEEEEEEEccccccccccccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEccccEEEEEEcccEEEEEEccccEEEEEEEEEEcccccEEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEEccccccccccEEEEEccccccccEEEEEEcccEEEEEEcccccccEEEEEcccccccccccEEEEEEccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccEEEEEEccccccccEEEccccEEEEccccccccccEEEEccccccccccccccccHHHcccccccccccccccccccHHHHccccccccEEccccc //