[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y40B1B.7
DDBJ      :             WW domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 15->118 CCD86_PONAB 1e-07 51.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA21606.1 GT:GENE Y40B1B.7 GT:PRODUCT WW domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE21790 WP:PRODUCT WW domain WP:LOCUS WBGene00012739 GB:PROTEIN_ID CAA21606.1 LENGTH 123 SQ:AASEQ MSTGANLLVMNDTCKSNRWWKTKQEKKHSEIKKVKTLKSTWDKKMELKAKKDMVKRVQDNIREKQVQERQEKKERKVEQEKRRLENERKAEIVQKITKIHKLKKTKKRQLRSIQMRDTTQVTK BL:SWS:NREP 1 BL:SWS:REP 15->118|CCD86_PONAB|1e-07|51.9|104/360| SEG 62->83|rekqvqerqekkerkveqekrr| SEG 94->111|qkitkihklkktkkrqlr| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 21-30, 34-35, 37-48, 50-51, 105-123| PSIPRED ccccccEEEEccccccccEEccccccHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccc //