[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y67H2A.5
DDBJ      :             nucleolar protein required for pre-rRNA splicing
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   106->129 PF05767 * Pox_A14 0.00053 33.3 24/92  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAC44306.1 GT:GENE Y67H2A.5 GT:PRODUCT nucleolar protein required for pre-rRNA splicing GT:ORG cele0 GT:DATABASE WS208 WP:CE CE28376 WP:PRODUCT nucleolar protein required for pre-rRNA splicing WP:LOCUS WBGene00013463 GB:PROTEIN_ID CAC44306.1 LENGTH 145 SQ:AASEQ MSLALRKTLGVARFSMRTASFQAVPTNAGKTPPTLEQFDPLNPGEWQLGAGGKILPRLPEGTKCGNLVMGKYGLYDPILKKRVDTYANALLEGKKSEEAGPFDVAVSKIAKVLSYICFVIAIYNLISLVNGTPLPPLSHVKAPGS TM:NTM 1 TM:REGION 105->127| HM:PFM:NREP 1 HM:PFM:REP 106->129|PF05767|0.00053|33.3|24/92|Pox_A14| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 141-145| PSIPRED cccHHHHHHHHHHHHHHHcccEEcccccccccccHHHccccccccEEEccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //