[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y73F4A.2
DDBJ      :             protein kinase
Swiss-Prot:DMON1_CAEEL  RecName: Full=DOMON domain-containing protein Y73F4A.2;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:168 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   36->117 3c09H PDBj 6e-04 25.6 %
:RPS:PDB   25->137 1d7cA PDBj 5e-12 23.0 %
:HMM:PFM   25->140 PF03351 * DOMON 3.9e-20 17.9 112/125  
:BLT:SWISS 1->168 DMON1_CAEEL 2e-91 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAA21754.1 GT:GENE Y73F4A.2 GT:PRODUCT protein kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE20368 WP:PRODUCT protein kinase WP:LOCUS WBGene00013515 GB:PROTEIN_ID CAA21754.1 LENGTH 168 SQ:AASEQ MFRSIAVLSALLFAFASAKTCKYDSSDFEVYWRFANNSINMQFMNTDIKNNEWTGVGFGDDKNNFVGVFFMVSNNQVTVRTGSTTQHGPPTFTQSGTNTASVSTQALNYFPEDKTMSAVVQIPIQFNGRSLQSCQKWRFVKSGKIENGQLTRNDKSPKEKKVCPMECN SW:ID DMON1_CAEEL SW:DE RecName: Full=DOMON domain-containing protein Y73F4A.2;Flags: Precursor; SW:GN ORFNames=Y73F4A.2; SW:KW Complete proteome; Glycoprotein; Secreted; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->168|DMON1_CAEEL|2e-91|100.0|168/168| GO:SWS:NREP 1 GO:SWS GO:0005576|"GO:extracellular region"|Secreted| TM:NTM 1 TM:REGION 1->19| SEG 8->18|lsallfafasa| BL:PDB:NREP 1 BL:PDB:REP 36->117|3c09H|6e-04|25.6|82/216| RP:PDB:NREP 1 RP:PDB:REP 25->137|1d7cA|5e-12|23.0|100/189| HM:PFM:NREP 1 HM:PFM:REP 25->140|PF03351|3.9e-20|17.9|112/125|DOMON| OP:NHOMO 7 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------43-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 66.7 SQ:SECSTR ########################TTTEEEEEEcccccccEEEEEEEETTccEEEEETTcccccccEEEEEEETTEEEEEEEEcccccccEEEEEcccccEEEEEEEEEcTTccEEcEEcccEEEEE#EEEETTTcc############################### PSIPRED cHHHHHHHHHHHHHHccccEEEEEcccEEEEEEEEccEEEEEEEEccccccEEEEEEccccccccEEEEEEEEccEEEEEEEEEEEcccccccEEcccccEEEEEEEcccccccEEEEEEEEEccccccccccccEEEEEccccccccEEEEEccccccccccHHHcc //