[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : Y74C9A.2
DDBJ      :             protein kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->81 PF11150 * DUF2927 6.1e-05 22.7 66/213  
:BLT:SWISS 54->120 S27A5_RAT 6e-04 45.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID AAF36049.1 GT:GENE Y74C9A.2 GT:PRODUCT protein kinase GT:ORG cele0 GT:DATABASE WS208 WP:CE CE24660 WP:PRODUCT protein kinase WP:LOCUS WBGene00022276 GB:PROTEIN_ID AAF36049.1 LENGTH 123 SQ:AASEQ MKLVILLSFVATVAVFAAPSAPAGLEEKLRALQEQLYSLEKENGVDVKQKEQPAAADTFLGFVPQKRMVAWQPMKRSMINEDSRAPLLHAIEARLAEVLRAGERLGVNPEEVLADLRARNQFQ BL:SWS:NREP 1 BL:SWS:REP 54->120|S27A5_RAT|6e-04|45.0|60/690| TM:NTM 1 TM:REGION 2->24| HM:PFM:NREP 1 HM:PFM:REP 12->81|PF11150|6.1e-05|22.7|66/213|DUF2927| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 43-49, 121-123| PSIPRED cHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccc //