[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZC15.6
DDBJ      :             zinc finger protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.169.1
:230 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  49->226 1tdqB_ d.169.1.1 * 4.4e-13 24.0 %
:HMM:PFM   71->107 PF03057 * DUF236 0.00028 36.1 36/141  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB07713.1 GT:GENE ZC15.6 GT:PRODUCT zinc finger protein GT:ORG cele0 GT:DATABASE WS208 WP:CE CE16687 WP:PRODUCT zinc finger protein WP:LOCUS WBGene00013834 GB:PROTEIN_ID CAB07713.1 LENGTH 230 SQ:AASEQ MKSVTVFLLAGTTFAIYFDGKGSRHSSSSSEEHGGHGPRPGPGGPGRGGNCSPGWLRFERQSGVWCVFVGLAGINDNSFAQKDGQSACVALGATLTGFQNDKERMAVADEAGRKLGAAGGGIAGLWLGATTRAGCKAGACGPLNTFMWTDGVTTGTAGLKWATGEPDSVDYPGTAACIQQFIMLPNWVPGPYDLEGFRTGFTHGILYKFSCIAPVTPGTRMFACGKMAAG SEG 22->49|gsrhssssseehgghgprpgpggpgrgg| SEG 111->129|agrklgaagggiaglwlga| HM:PFM:NREP 1 HM:PFM:REP 71->107|PF03057|0.00028|36.1|36/141|DUF236| HM:SCP:REP 49->226|1tdqB_|4.4e-13|24.0|125/126|d.169.1.1|1/1|C-type lectin-like| OP:NHOMO 40 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------CS-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 18-49| PSIPRED cHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEEccccccccHHHHHHHHHHcccEEcEEccHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccEEEEcccccccccEEEccccccccccccccEEEEEEEEcccccccccccccccccccccEEEEEcccccccccEEEEEEcEEccc //