[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Caenorhabditis elegans (nematode) (cele0)
Gene : ZC376.8
DDBJ      :             DNA binding domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:278 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   149->253 PF03057 * DUF236 2e-07 39.8 %
:HMM:PFM   153->266 PF03057 * DUF236 1.1e-35 45.0 111/141  
:HMM:PFM   27->143 PF07423 * DUF1510 7.6e-08 25.6 86/217  
:TM
:REPEAT 2|187->204|228->245
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD WormBase Abbreviations Back to title page
GT:ID CAB00885.2 GT:GENE ZC376.8 GT:PRODUCT DNA binding domain GT:ORG cele0 GT:DATABASE WS208 WP:CE CE38013 WP:PRODUCT DNA binding domain WP:LOCUS WBGene00013879 GB:PROTEIN_ID CAB00885.2 LENGTH 278 SQ:AASEQ MAFAFWQIVDWNHVAFHLWSLLGLVSIAMTVFVCGKPKKKKDVSGAPSAESPPPPPPAPKVPEPPKAPPPADAVKKIEEKGEEKKPEEPAKSKKSEKKEKSKNEGSKKEEDKEKEKEKSNKAEDKKSEDPKKEDAKKPDVKGKDTFKKPVDESAVAPKKDPNYQTLCGLNNDLFGPDKNPKKQFKAPTKVEKADVKDPQYETLNGLGEEMFKDEKKDDEGKKKEFKQPDKVQKADAKDPQYETLNEVDKGIFNNEEKKSEKKDAEKKDDKEEKKSEIK TM:NTM 1 TM:REGION 13->34| NREPEAT 1 REPEAT 2|187->204|228->245| SEG 46->143|apsaesppppppapkvpeppkapppadavkkieekgeekkpeepakskksekkeksknegskkeedkekekeksnkaedkksedpkkedakkpdvkgk| SEG 207->226|geemfkdekkddegkkkefk| SEG 255->276|eekksekkdaekkddkeekkse| RP:PFM:NREP 1 RP:PFM:REP 149->253|PF03057|2e-07|39.8|103/113|DUF236| HM:PFM:NREP 2 HM:PFM:REP 153->266|PF03057|1.1e-35|45.0|111/141|DUF236| HM:PFM:REP 27->143|PF07423|7.6e-08|25.6|86/217|DUF1510| OP:NHOMO 6 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------24-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-278| PSIPRED ccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcc //